Identifiers and Description

Gene Model Identifier

Contig20793.0.g60

Standard Name

None

Aliases

Contig20793_0_g60

Description

Guanylate-binding protein, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam02263 ) Guanylate-binding protein, N-terminal domain
  • ( pfam02841 ) Guanylate-binding protein, C-terminal domain
  • ( pfam13481 ) AAA domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006572409.997093137033517e-262Guanylate-binding protein, N-t
erminal domain ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20793.0.g60(coding)
ATGTAGTCAAGTCGCTATGAGAAAGAAGCTTTCGTTGAGGAAGCTATACCTTTCATTATT
TATGACCCTGAAACTAGAAAATTTGTATTGACGTAAGAAGCAATTGAAATTTTGAGAAAT
ATTGATGGGCCCATTGGATTGTGTGCTGTAGCAGGAATGTATAGAACTGGAAAAAGTTAT
CTCCTCAATAGAATGCTTTTAAACAGATCAAGTGGATTCGGAGTTGGGCCATCCATCAAT
CCTTGCACTAAGGGATTATGGCTATGGGGTAAACCAGTTCCAGGAACTACTCCTGATGGA
GAACCTATCAATGTTTTGATTGTAGACACTGAAGGTCTCGGTGCTCTTGATGAAGATTCA
AACCATGATGTCAGAATCTTTTCACTTGCTATCTTGCTAAGCTCTTATTTCTTGTATAAC
AGTGTTGGAAGCATTGATGAGAGTGCATTGCAAAATTTATCATTAGTGATTAACCTTACT
AAACACATTCATATCAAATCAAGAGGTGGTGATGATATTGACACTGAAGAATATGGAACC
TACTTCCCATCTTTCATGTGGATAGTCAGAGATTTCACTCTTCAACTTGTCGATTAAGAA
GGAGAAGCCATTTCTTCCAAGGATTACTTGGAGAAAGCTCTCGAAATTCAAAAGGGTTTC
TCTGATAACGTTGAGTCTAAGAACCGTATTAGAAGACTCATGAAAAGTTTCTTCAAAGAG
AGAGATTGCTGCACTATGATCAGACCTTTAACAAATGAGGAAAATCTTTAAAATTTAACT
AACATGGACCTCGATGAATTGCGACCAGAATTTATCGAACAAGTCATGACTTTGAGACGC
AAAGTTATGAACAGAATTAAGCCAAAAATGCTTAACGGTAAAAAGTTGACAGGTTAAATG
ATGGCTACCTTGGCTGAATCATACGTTGAGTCAATAAACAACGGAGTTGTACCAAACATT
GAAAACGCATGGTCTTACATTTGCAAGAGTGAGTGTCACAAGGCTATTGAAGAGAGCATG
CAGAGATTCGAGGCTTTCTTGAGAGAATCAGTTGTCCCAAAGATTCCAATGGACGATGAA
GAGCTCAAGGAGTGTTACTCAGATGCCAAGAAAGAAGCTTTAGCTTTATACAGTAAGAAA
GCAGTTGGAAGCATTGCTGATGAATACGTGAAAGAGCTCAAGAACAAAATGCAAACACTC
TTCAATCAAATTAAGGATGAAAATGAGAGAGAAGCTGTGCATGCAAGTTAGATGTTCTTA
CAAGAGACTTACAGTTACATTGAAAGAAGACTCAAGAATAAAGAGTTTGGCAGCTTCATG
GAATATGAGAAAGACATCATGTCATTCTAACAGTACTTCTTGGAGAATGGACCTCCTGGA
CCAAACAGGAGAATGATTCTACTGGAGTTTTCTCAAAGAGCCATCACAGAAGCAGCTGAT
TTCTTCTCTAAGTCTATTATGAATGAATTGCACCTTCAATAAACTATCTAGTAAGAGCAA
CATAAGAATCTTGAGGCGCAACTAAAAGAACTTAAGACTGATCACATCAGAGAGAAAGAT
TAGTTTGAGACAAAATTAAGAATGGCCGAAGTTGAAAAAGCTGAACTCTCAGCTATAGAA
CAAAGTCTCAGAGAAAACCTTGATAGAATCCAGCAAGAAAAACAAAGTAATGAGAGAGAA
CTCATGGAGCAAGCAGACAGATTAAAGAAAGAGTTCCAAAGAGAAATCGAAGATTACAAG
CACAAACTTCAATCTCAAGATCAAGTTACAAACGATCTTTAAAGAAAAGTTTACCAAACA
GAGAGTGAGAACGAGAAGGAATAGGCTCTGCTTGAGTAAAAGATTGAGTTCTTGGAGAGA
ACCATCCAGGATTATCAAAAGAAAGAGAATGAGTACTCTTCTGAGTTGAAGAAGGAGAAG
AAGGATCATTAATAGTGGGCTAGGGATGTTTAAACCAAATACGAACAGCAAATCAAGAGC
TTGAATGTGAAGCTTGACGAAACCACTGAAAAACTATAGGAGTTCTAATCTTCATACGAA
GAACTTGAACAAAAGTACACCTATGAAAAGCAAAAGTGGGAGGATAATCAAGCCAGTCTC
AAAAACAACATGACTATGAGTCAGACCCAATACAATGAGATGCAAAGAACTATCGAGGAT
CTCAAGTTGAAGAACAGAACTGAAACAGAGAAGCTTCAATTTGATCTATAGGACATCAGA
GAGTTCAGTAGACAAAAGGAAGAAGACCTTGAGTCTCAGTTGAAGGAGAGAGATGAGGAA
ATCAAGAACATGAAGAACATGTTTGAGAAGGAACTCGCTATCTTCAAGCAGAAACTCGAA
TTCAAGGATGTTCAAAATCAACAGATTAAGGCTCAACTTGATGAATCAAGAAAGGGCCAT
GAACAGATGCTTAAAGCAGTAGAAGGCAGAGCTAGGGAATCAAACGATGGCAAAGAGACT
GCCTTCAAGTAAGTTGAAGAATTAAAGGAATTGCATCAATAAGAAATGAATGAGCTCATC
TAGAAATTCAACAGTACTCGATCATAACTTGAAACTCAAGTTGATATTATCAATGAGAAA
TACTCAGAGTTAGAACTTTAGCACAAACTACTTCAGTCAGAATTTGAAAAGGAAACTGAA
AATCTTCAGTAGTAACTCCACACTACAGAAGGTCAAAAGCAAAGAGCCCTTGATCAAAGC
AAGAACACTGACACTCAGAAATTGAAGCTTTTAGAAGAGACTGAAATCAGATACAAGCAA
CAAATTGCTTTGTTGGAAAGAGAGCTTGACGATCTTAACTTGAGATCTCAAGAAGAACTG
AGAGAACTCTAAGAGAAGTCGGAAGAGTCTCTTGCTCAATTAAAGAACACCTATGAAATT
GATAAAGTCAGATTGGAGCACAGACTCGCTGAAGAAAAGGAAAGAGCTTAAAAGAAAATA
TCCCAACTTCAGGAAGAATTTGACCAAAGACTAAGAGATGAATAGCAACAACACGAGGAA
GACATTGAAATGCTTTAAGAAGAGCTAAGAGAGAACGAGAGAAGAAACTCAAATCTCATC
AATCAACTAGATCACGATAATGCTCTTATGAGTCAAAAGATAGAAACCTTGGAGGTTTAT
TTGAGAGAGAAGGAAGATAGACTCTCAAAAGAGTAAAATATGACAGCTTCTCAAATTGAA
GCCTAACTAGAGAGATTCAATAATGAGAGAAAGGAGCTTTTCACCAAGATTGAACAACTT
AATCACACTCTTACCACCAAAGACAGAGAGCTTACTATCATCAAGAACAAGCTTGAAACT
GCTGTTGAAGAGGCTGATAAGAAAAAGAAAGCTCTTGAGGAGAACAAGCAAGAAATTAAC
ACTGAGAAGAATAAGCTTAATGAAAAGATTGAGCAGCTAAGATCCAAAAATCAAGAAATT
ACTGATGAGTTCATGTAGAAAAAACTTGAGGATGGTAGAGAAATTGCTCTTTACAGATAG
AAACTTGAATTCCAGCAGAAGAAGATTGATGACCTTTAAAAGTAGTATGATGATGTTTCA
GCAAAGTATGATGAGAGACTTGTACAATAGAAACAAGAATACCAATAAGATATTCAAGAA
ACTATCATGAGAATGAATCAACAAAGAGAACAGAGTGAACAAAAGTACGAGCAAAAGAGA
AAGGCCTTCAAGGATCAAGAAAACATCTATCAAAAGCAAATCTCTGAAATTTAAAAGGAG
AGAGCCGTTCTTGAAGAAAAGCTTTATAATGCTGATTCTAGAAAAGATGAAATTAGACTT
AAGTATGAGTAGGAAATTGATCACTTAAAGGAGCAATTAATGATTGCCTCTGAGACAGTT
GGCAAAGAAAGAGAAATGCTGCTTACTGATAATGATAGACTCAAGCAAGCTCTAATTGAC
CTTGAAAGAGATTACTCTGAAATTAAGTCAACTTATGATAAAGAGAAGGCTCTCTGGGAA
GGTAGATGCAGCTTCCTTGAATAATTGAAGGATCAAGCTAAAGCTGATTTGTAAGAAGCT
CACAAGAAGTTCGAGCAGACTATGGAGTAGATTAACAAGAGAAACCAAATGGACAAGGAA
TCTAAGGATAATAACAATGGTTCATTAATGGCAAATCTTGAGCAAAAGTTCAGATAACAG
ATGAAAGATTAACTAGAGCAAAGCCAAAGATAAGCTTCAGAATATAACGAGAAATGCAAG
TATCTTGAAAAAGAAAATAGACAACTTCAAAGCAGACTTCAACTTGAGCAAAGAGATAAG
ATGACAGATCATGATAGCATGGAGAAGAAGATTAACGAACTCTATGAGAATGAACAAAGA
ATCCAAAAAGAGATGGAAGAAATGAAGTAAGAAAGAGACAAGAGAATCGTTGATCACCAA
AGAGCACTTGAGAAAGATAGAGAAGTCTACAAAGCTAAGATGAGTGAAATTGAACAAAAA
TGTAAAGATCTTGAAAACAGAAGATCAACAATGATCTTTGAGTTTGAGAAGGAAAGAGCA
AAGTGGGGACTTGAGAAAGATTTCCTAGCTACTCAAAAGTAAGAAGTTCAAGAGCAATTG
GATAGAATCCAAAGAAGAAATGAGCAACTCTTGAAAGAAAACGAGAGACTCAAGAGTGAG
AAAAATAAGAAAGGCTATCTTTATGGTCAAGGAGCTTCAGGAGCTGGAGTTGGTGGAGCT
GCTGGTTATGCTAGTAAGTTCAATTCAACTGCCTTCGGTCAGCACTTATTGAAGGGAGTT
GGTCAAAAGGAAAACTCAGTAAGCTAGGCTTTCCCATCAGGATTCGCCAAATTCATTGGT
GATGGATAAAGAGACTAAGAAAAGCCAGACCCATCTTCACTTCCACTTTCCTCTAACATT
TAAAATTCAATGAGAGGTTTCCTATAAAGCCCTAACCCTGCCGCTTTCATGGGACATCAA
AAGTAAGGTTCTTCAGGAACACTCAGCTACTAGTCAGAAAGTAACCAAGGTAAAAATGAG
TTCGGAGGTGCTTCATCTACAGATGAAACCCTCAGTTAAAACTGA


>Contig20793.0.g60(protein)
MQSSRYEKEAFVEEAIPFIIYDPETRKFVLTQEAIEILRNIDGPIGLCAVAGMYRTGKSY
LLNRMLLNRSSGFGVGPSINPCTKGLWLWGKPVPGTTPDGEPINVLIVDTEGLGALDEDS
NHDVRIFSLAILLSSYFLYNSVGSIDESALQNLSLVINLTKHIHIKSRGGDDIDTEEYGT
YFPSFMWIVRDFTLQLVDQEGEAISSKDYLEKALEIQKGFSDNVESKNRIRRLMKSFFKE
RDCCTMIRPLTNEENLQNLTNMDLDELRPEFIEQVMTLRRKVMNRIKPKMLNGKKLTGQM
MATLAESYVESINNGVVPNIENAWSYICKSECHKAIEESMQRFEAFLRESVVPKIPMDDE
ELKECYSDAKKEALALYSKKAVGSIADEYVKELKNKMQTLFNQIKDENEREAVHASQMFL
QETYSYIERRLKNKEFGSFMEYEKDIMSFQQYFLENGPPGPNRRMILLEFSQRAITEAAD
FFSKSIMNELHLQQTIQQEQHKNLEAQLKELKTDHIREKDQFETKLRMAEVEKAELSAIE
QSLRENLDRIQQEKQSNERELMEQADRLKKEFQREIEDYKHKLQSQDQVTNDLQRKVYQT
ESENEKEQALLEQKIEFLERTIQDYQKKENEYSSELKKEKKDHQQWARDVQTKYEQQIKS
LNVKLDETTEKLQEFQSSYEELEQKYTYEKQKWEDNQASLKNNMTMSQTQYNEMQRTIED
LKLKNRTETEKLQFDLQDIREFSRQKEEDLESQLKERDEEIKNMKNMFEKELAIFKQKLE
FKDVQNQQIKAQLDESRKGHEQMLKAVEGRARESNDGKETAFKQVEELKELHQQEMNELI
QKFNSTRSQLETQVDIINEKYSELELQHKLLQSEFEKETENLQQQLHTTEGQKQRALDQS
KNTDTQKLKLLEETEIRYKQQIALLERELDDLNLRSQEELRELQEKSEESLAQLKNTYEI
DKVRLEHRLAEEKERAQKKISQLQEEFDQRLRDEQQQHEEDIEMLQEELRENERRNSNLI
NQLDHDNALMSQKIETLEVYLREKEDRLSKEQNMTASQIEAQLERFNNERKELFTKIEQL
NHTLTTKDRELTIIKNKLETAVEEADKKKKALEENKQEINTEKNKLNEKIEQLRSKNQEI
TDEFMQKKLEDGREIALYRQKLEFQQKKIDDLQKQYDDVSAKYDERLVQQKQEYQQDIQE
TIMRMNQQREQSEQKYEQKRKAFKDQENIYQKQISEIQKERAVLEEKLYNADSRKDEIRL
KYEQEIDHLKEQLMIASETVGKEREMLLTDNDRLKQALIDLERDYSEIKSTYDKEKALWE
GRCSFLEQLKDQAKADLQEAHKKFEQTMEQINKRNQMDKESKDNNNGSLMANLEQKFRQQ
MKDQLEQSQRQASEYNEKCKYLEKENRQLQSRLQLEQRDKMTDHDSMEKKINELYENEQR
IQKEMEEMKQERDKRIVDHQRALEKDREVYKAKMSEIEQKCKDLENRRSTMIFEFEKERA
KWGLEKDFLATQKQEVQEQLDRIQRRNEQLLKENERLKSEKNKKGYLYGQGASGAGVGGA
AGYASKFNSTAFGQHLLKGVGQKENSVSQAFPSGFAKFIGDGQRDQEKPDPSSLPLSSNI
QNSMRGFLQSPNPAAFMGHQKQGSSGTLSYQSESNQGKNEFGGASSTDETLSQN