Identifiers and Description

Gene Model Identifier

Contig20780.0.g106

Standard Name

None

Aliases

Contig20780_0_g106

Description

Dynein light chain type 1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR424C9.99967697349061e-30DYN2 SGDID:S000002832, Chr IV
from 1319617-1319387,1319...
T. thermophilaTTHERM_009718401.9994498063102785e-22Dynein light chain type 1 fami
ly protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20780.0.g106(coding)
ATGGCAGACAGGAAAGCAGTCGTCAAGAACGCAGATATGTCCGAAGATATGCAGTAGGAC
GCTATTGACATTGCTACCCAGGCCTTGGAGAAGTTTAACATCGAAAAGGACATTGCAGCA
TTCATCAAGAAAGAGTTCGATAAGAAGTACAACCCCACATGGCACTGTATCGTAGGAAGA
AACTTTGGTTCCTACATCACCCATGAGACTAAGCACTTCATCTATTTCTACCTCGGCTAA
GTAGCCGTCCTCCTCTTCAAATCTGGCTGA


>Contig20780.0.g106(protein)
MADRKAVVKNADMSEDMQQDAIDIATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGR
NFGSYITHETKHFIYFYLGQVAVLLFKSG