Identifiers and Description

Gene Model Identifier

Contig20776.0.g62

Standard Name

None

Aliases

Contig20776_0_g62

Description

Male gamete fusion factor

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam10699 ) Male gamete fusion factor
  • ( pfam05266 ) Protein of unknown function (DUF724)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010756405.00115835552873e-49hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20776.0.g62(coding)
ATGACTTTTAATATAACCAAAGTTGAGAACAGTACAACAGGGGAAATGTAGCAATTAAAT
CAGTGGATATAGATAGGATTCAAAAAGAGTGCTGCACAAATAGTTTACGATCTAACTTAT
GTGCAAGATTTTTATGCCTCAGTGACTGAGCAGGTGGTTTACACTTAAAGTATATTTTGC
GACGACTCTTACAATTCAAATGATCCTACTTGCGGATGGCAATATGATAAAAATGGGAAT
AAAATCTAATACTCTCAGGGGTTTTGTTGTGACTGCCCACTTAGTGACATATTCACAATT
GCTGATAAAGAAACTAGAGGATTTTCATGCATATTGGCAAATACTTTTTATGCTACTGCT
CATTGTCTCAAATTTAGTTCTGAGAGGTTTTCTGCTTATAAAATATCTCCACCGAGAGTT
GAATATACTATAACTGCCTAAATTCAAATATTCGATAAAAATTACAATTTTTATCGGCAA
TATGACATCAATCTGCGACCAGATAGAAGAGAGAAAGTTATTGACGACAGTATTTATATC
TCAATTATTGGGGACTTTATGCCAACATAATTCCCAGTTTACTATAATAATGAGATACTG
CTAGTACCCTCGAAAGACTATGGCTACAATTTTTATAGCACATTCGATAATTGCGAATAT
TGCTTGCTAGTTGATAGAGAAATGATAACGATGACAGGCCTAGAATGTGACAAGATTGGG
ACTTCATACTACGCATTTTAAACTGCTGGTGATAAGTGTGATTAGCCAGTATACACTTGT
CTGAAGCTCTAAATTCAGGATTTGATAATTGATGATTTTAAAAGGATATAAGATAAGAAA
ACTCCAAACTATTTGCTCAATCATGTTGGAAGTAAAACTGGGCTTAAATTTGTACAGGAA
ACTGGATAACTGGCAGCATCTTGTCCATATGTTTAGAGCACACAACTGAAGTTTGAGGTT
AATACAGATCGAATGAGCTTCATAAGAGCAGTCGTTAAAATGAGCATCTCATAAGTTAAG
CTACTCAATAATGGTTTCGAAGGCTATACAAATTTTGGCTTGATCATGATAAATATTCGA
AACGATGAAGATTTAGCTGGGGAAGGGTAGTTATCAATATCTAACTGCTCTGATTTTGTG
ACATTCTTTGGCAACTCAGTTTAAGTAATTAGTGTACCAGCATATTCAGAGAGATCTTAT
AACTTTACTGTTGGATCAAACAGTAATCTCCCAATTGAAAATAATACTTGCAGTATACAA
CTTACAAATAGCATAGGTAGCATTCTAGAGGACAGATCAGTTTAATTTTAAACTACAGCC
ACCAACTACCAGACAGTTGTTGAAGTTGCTCAAGGGATTTTAAGTCAACAAAAAGAAGCT
GAATACTTATTAAGCAAGGAGTACCTATGTGGTAAATGTGATCTGGAAGACTTCTTCTTC
GCACTTTTTTGCTATTTTTATGAGGTCTGTACTGATTAAATCTTAAGAATAATTTTCGTA
TACATATTGATGCCATTCTTGTTTGCAGTATTAATTTTCACTTGTTTGCCTTGCAAATTA
ATAAAGTGGCTCTTTTTAAAGATAAAATGTTGTAAAAAGAAAAAATAAGAAAAAGACATT
GAAAATTCTATCGATAAACAAGCAGATATTAGTGCATTCAAGCAGGAAATTTAAAAATTG
AAGAGAGACAGATACTATATGAAATACTAATTGGAGAAGGATAGAACTAAAAATTTATAG
AGTTAAATATAGATGGATTCCATCCTCTAGAAAAGCCAAGATATAACTTTAAACTCTATT
AACATCAGTAGTAGTAGCAAAGAAGATTTTCATCAGAAAAGGCTTGAAAAAAGTAACTTC
ACAAATGATTCATTCTCTAGAATACTTAACTCTACATCTATTGAAAATTCACATGTCTCT
AATTTAAATCAAGTTGAATCTAAATCAGCAAATAATTTAATCAGCAGGCATAAATATATT
GAAGAAAATTAAAATTCAGATATTAAGTAGTTAGGGCACAAAGAGTAACTTAATTTATAA
AATATCAATGAACAAATTGGCATAAATTTACAAATGACTTCAAATCAAGAGAATCCTGAA
GCAATAATTAATTTTGGGTAAACAGAGACTAGAAAACCAATGCCAACCATTCAAGAGAAG
AAATTTGCAAGTTTTTAATGTATAATAGAACAGGAGGGTTGGAGAGAATCTTAAAGACCA
AATAAATCTGTCATAAATCTACCCGATTGGATTTGA


>Contig20776.0.g62(protein)
MTFNITKVENSTTGEMQQLNQWIQIGFKKSAAQIVYDLTYVQDFYASVTEQVVYTQSIFC
DDSYNSNDPTCGWQYDKNGNKIQYSQGFCCDCPLSDIFTIADKETRGFSCILANTFYATA
HCLKFSSERFSAYKISPPRVEYTITAQIQIFDKNYNFYRQYDINLRPDRREKVIDDSIYI
SIIGDFMPTQFPVYYNNEILLVPSKDYGYNFYSTFDNCEYCLLVDREMITMTGLECDKIG
TSYYAFQTAGDKCDQPVYTCLKLQIQDLIIDDFKRIQDKKTPNYLLNHVGSKTGLKFVQE
TGQLAASCPYVQSTQLKFEVNTDRMSFIRAVVKMSISQVKLLNNGFEGYTNFGLIMINIR
NDEDLAGEGQLSISNCSDFVTFFGNSVQVISVPAYSERSYNFTVGSNSNLPIENNTCSIQ
LTNSIGSILEDRSVQFQTTATNYQTVVEVAQGILSQQKEAEYLLSKEYLCGKCDLEDFFF
ALFCYFYEVCTDQILRIIFVYILMPFLFAVLIFTCLPCKLIKWLFLKIKCCKKKKQEKDI
ENSIDKQADISAFKQEIQKLKRDRYYMKYQLEKDRTKNLQSQIQMDSILQKSQDITLNSI
NISSSSKEDFHQKRLEKSNFTNDSFSRILNSTSIENSHVSNLNQVESKSANNLISRHKYI
EENQNSDIKQLGHKEQLNLQNINEQIGINLQMTSNQENPEAIINFGQTETRKPMPTIQEK
KFASFQCIIEQEGWRESQRPNKSVINLPDWI