Identifiers and Description

Gene Model Identifier

Contig20768.0.1.g69

Standard Name

None

Aliases

Contig20768_0_1_g69

Description

Calcium-activated chloride channel

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007706807.996975020896894e-36hypothetical protein
SGDYBR086C0.00000000019994075865167896IST2 SGDID:S000000290, Chr II
from 423041-420201, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20768.0.1.g69(coding)
ATGTTGAATAAAATTCTTTGTAAAAAGTAACAGCAAGATTCTAGAGCAATAGCTTTTCTG
GATTATTGCAAGGATGGTATCTTGGATTTAGTTTAAACGATCTATGAGGCTTACGCACCA
AGAGGGGCTCTTCTAATTGCAAGGGATGACGATGGAAAAACTGCACTTCACATGGCTGCG
TACTATGGTCATGACGATGTCTTGGAATATTTAATTCTTGAAGCTAAGGAGTGTCAATTA
CACATGGATCCAATCGACAATCTTGGTTTTACACCTCTTTTATATGCATGCTTCAGAGGT
TATGATGATATGGAGGAAGACGCAGTTCAAGATAGAATAAAGTGTGTAAAAATGTTGGTA
GAGGCTGATGCAGATTTAAATTTCAGAAAATCCACCACTTTTTTGACTCCCCTTCATTGG
GCAGCTTTTAATGAGGATAAAAACTCGGTGCTGTACTTGCTATAGAATGGGGCGATACTG
TAGAGGGGTTTTAATCTTCACACTCCTTTGGATATAGCTGGAATCTGTGATAACAAAGAG
ATTGTAGAGACCATTCTTCTCTTCTGGTTTAATAAAAACAAGAACGGTGATAAGAAATAT
CTTTCTGAACCAAGCTAATACACAATGAATGAGAAAACTTTGAGACCAAGTTAAGTCTCC
CCAGGGGATTTGGAATCCAAAGATTTTGGCCACAAAAAAGTAAAACTTCGATATGACAAC
CCAAAGGTCGAGTTAACAGAGCCTGAATCTATTATTTATGATATAATGTTCTGGGCAGCA
GGTCTAGGACTCAACTAAATCGTTGACCTTACTATATAAATGGGTTATTCACCATTTTAT
AAGACTTTCGATAGCTAAAATGCTTTAATGGCAGCCGTAGAAAGAGGACATGAAGATACT
GTGAAGTTAATATTAAGCTATTCATATGAATCATTTGATCCTGTGAAATTTGAGAAACTT
AAATGTGTAGTTGATAAGAATGGGAACACTCCCTTGCATTTAGCATTCAAGAGGGTACAT
TAAAACATCGCAACAATTTTAGATGAGAAGTTTCCATTAATGAAGGAAGAAAGGAACTTA
AGAGGACTCTTGCCAGATCAAATGTGCCACAAAAAGATTAAAGGAAAACAAAATAAAGAA
ATGCAAGATGCAGCTAAAAGTCTTGATCAAACTGCTTAATTGGAAAAGAAATAAAAAGAA
GATTGGGACATAGATGATGAACCAGACTACGTGTTCTATGTGAACTAGTTAAGAGCGCCA
TTATTGACTCTTTAACTTCAGGACCTAAATATTGATTTCAGAGAGTTTAGATCTGCTCTG
AATGAAAGCATGGTCATTATTGTAATTTACTTTTCAAATGAGTTGCTTGATTAAATGGCA
GAGATTTATGGGCTACCTGTTCGACTTCTTGACGAAAACTAAGCAATTCAGTTCAAAGAT
CACGCAGAAGAAAACTACGAGCAATTCTAAGCAAGGCAAAAGCAATTTCTCATGATGAAG
GTATTCGAACAGGAAATTGATATTGACTACTACACCAAGAATGGAGTTATAGTGGATCAT
TTCCCACTACATGATAAATTCAAAGAGACTATAGCAACTAGTTGGGAAAAATACAGATTT
AAGCTCTTCTTTGGTTTCATTACAGGGAGGTACAAGCACTACTTCTAACCCATTCATTTC
ATCGCAAGCTACTATGGTGAAAAGTAGGGCTTCTATTTCGCCTGGCATATGTTTTACACT
TCATGGTTGATGATTCCAGCTATCCCTGGTCTTGCTCTATTTATCTATTAAATGGTGATG
TTAGTAGATTAAAATAGTAAAAATGAAGTCTAAACTTTGGACAATCCTTACAATTGTCTC
TATTGCTTGATATTAGCTGTGTGGTCTACAGTTTTCTACGAAATTTGGAAAAGAAAAGAA
AGTGAGATAGCCTACCTCTGGAATATGACTAATTATCAAGGTGCAGACACAGAGATGCCT
GATTATAGAGCTGATTACATAATTGATGAAAAATAGAAAGCGATAAGAAAGGAGAATTTG
GCAAATTCATATATTAGAAGAGTATTTGGAGAGACTCCATCTGCTACAATTTCAGTTGGA
ATAGTTATCTTGTGTTTCTGGGGTTACAGATTGTTTTCTACATAGAACAAAAGTAATCCT
TCATTTTCAGTTGGTTCTTCAGTTGTTAATGCTATTGTAATTGTCGTTCTCGATATTCTT
TACAAAAAACTAGCAGATATACTTGTTAAGTGGGAGAATCATAGATATCAGGAGGACTGG
GAAAATTCTATGATTTCTAAGCATTTTGCTTTCAAGTTTGTTAATGCTTATATAGCGCTA
TTCTCTGTCGCTTTTGCAGACTAAAATTTTAATCTACTTGCATAAAATCTTGCAATCATT
CTAGCAGCTAAGAGATTAGCAACTGGTCTCATAAACATCACTGGTCCAAAGATCTAGGTA
TGGTGGAGATTGAGAAAGCTCAATAAAGCCCTTGCATCAGACTTCAAAGGGAAGCAAGAA
AAACTAGAAGATCAAAAGGTTCAAGAATTTGTTGAGAGATAATTGTAATTGCAACCTTAA
TCCAATGTATTGGTGGCGAAATACAGTGAAATTATCATTTAATTTGGCTACATTGTACTA
TTTGCTCAGGCTTTCCCTCTCGCCCCTCTCCTCTCAATTTTCATAAACTTTCTTGAAATG
AAAGCTGACATGAATATGATGGCCTTCTATTAAAAGCGTACTGTGGCTCAAGGTGCAACT
GGAATTGGAAGTTGGGGTGGAATCGTGGAGACTCTATCTTTCGTAGGTATCGGTGTTAAC
TGTGGAATTATCTACTGGACTTCTGACTCACTTAATGTTATACTGGAAGAGTATGACTAC
GATGAAACCTAAAAGTTCATGATAGTTAATGACGAGGAGGAGTATTTATATGAATTATTG
GATAAAAAGGCTGATGATTTAAGAGCAGAAAAAGATGTGAAGAAGCTGCCATTAGAAGAC
AAAATTAAAATTTACAAAGATAAACTTAAAGCCTAGCAGCATGAAAAAATTCTTTAATCA
AAAGGCTCAAGAGCTATCTTTAATTTAGATGAAATGAGAGATTTACTAGGGGATGTTGAA
CCTAAATATAATAATCAAAAAAGTAAAAAGAGATCCAAAAAACTAACACTATACGAGGTT
TAACAAGTCTATAATGACGAAGTGTCCAATGTACATAGTAAAGAAAAGAATAAAAGTAGG
AGAGAAATTCAGTAAGAAAGAAAAGACAGAAAGAAAGATTTACTCATGTAGAGATACGAA
AGCAAGAAAATTGAAGATATGGGAGATAAAGGAGATGAAGGGACAACTTATTTCATGTCC
TTGAAAATTTAACAACAAAGAAGGAAGAGTCAATTCTAGAAGCCATTGCCCACCCTACTT
GAAGAACAATAAAATTTCGCTCAGAATAATGAGAAGTTTATCAATGATCCAAGTGAGCAT
TCAAATCAATCAATGATTGATGCTGAAGATTATTAAATCAACCAGGATGCGAATTCAGGG
TGA


>Contig20768.0.1.g69(protein)
MLNKILCKKQQQDSRAIAFLDYCKDGILDLVQTIYEAYAPRGALLIARDDDGKTALHMAA
YYGHDDVLEYLILEAKECQLHMDPIDNLGFTPLLYACFRGYDDMEEDAVQDRIKCVKMLV
EADADLNFRKSTTFLTPLHWAAFNEDKNSVLYLLQNGAILQRGFNLHTPLDIAGICDNKE
IVETILLFWFNKNKNGDKKYLSEPSQYTMNEKTLRPSQVSPGDLESKDFGHKKVKLRYDN
PKVELTEPESIIYDIMFWAAGLGLNQIVDLTIQMGYSPFYKTFDSQNALMAAVERGHEDT
VKLILSYSYESFDPVKFEKLKCVVDKNGNTPLHLAFKRVHQNIATILDEKFPLMKEERNL
RGLLPDQMCHKKIKGKQNKEMQDAAKSLDQTAQLEKKQKEDWDIDDEPDYVFYVNQLRAP
LLTLQLQDLNIDFREFRSALNESMVIIVIYFSNELLDQMAEIYGLPVRLLDENQAIQFKD
HAEENYEQFQARQKQFLMMKVFEQEIDIDYYTKNGVIVDHFPLHDKFKETIATSWEKYRF
KLFFGFITGRYKHYFQPIHFIASYYGEKQGFYFAWHMFYTSWLMIPAIPGLALFIYQMVM
LVDQNSKNEVQTLDNPYNCLYCLILAVWSTVFYEIWKRKESEIAYLWNMTNYQGADTEMP
DYRADYIIDEKQKAIRKENLANSYIRRVFGETPSATISVGIVILCFWGYRLFSTQNKSNP
SFSVGSSVVNAIVIVVLDILYKKLADILVKWENHRYQEDWENSMISKHFAFKFVNAYIAL
FSVAFADQNFNLLAQNLAIILAAKRLATGLINITGPKIQVWWRLRKLNKALASDFKGKQE
KLEDQKVQEFVERQLQLQPQSNVLVAKYSEIIIQFGYIVLFAQAFPLAPLLSIFINFLEM
KADMNMMAFYQKRTVAQGATGIGSWGGIVETLSFVGIGVNCGIIYWTSDSLNVILEEYDY
DETQKFMIVNDEEEYLYELLDKKADDLRAEKDVKKLPLEDKIKIYKDKLKAQQHEKILQS
KGSRAIFNLDEMRDLLGDVEPKYNNQKSKKRSKKLTLYEVQQVYNDEVSNVHSKEKNKSR
REIQQERKDRKKDLLMQRYESKKIEDMGDKGDEGTTYFMSLKIQQQRRKSQFQKPLPTLL
EEQQNFAQNNEKFINDPSEHSNQSMIDAEDYQINQDANSG