Identifiers and Description

Gene Model Identifier

Contig20746.0.g28

Standard Name

None

Aliases

Contig20746_0_g28

Description

Domain of unknown function (DUF4215)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam13948 ) Domain of unknown function (DUF4215)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003134107.996806159126539e-24hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20746.0.g28(coding)
ATGGATATTACTCTATCATCTGTTCCACTTTGCAGGAGTAGCTATTTCCAATACATTTAT
CCTTTCAACCAAGCAGATCTAGGTTCAGATGATCTTGCTTATACAATGAACATTTGGTGG
AAGCCTATAAGTTTTGAATCAGAATAATTATTCTTTCAATTTGGCACCCAAATTTTGCAG
CTAGGAACTGAAGAATATACAGGGAAAATGTACTTTACAGCTGGGGGCCTTCAGAGTAAT
AACACAAGTATAATCTCAGGTCCACTAAATCCAATTTACCCTTAATTTAATCAGTGGTAG
TTTTTAAGCGTTAGGAAAAGTCCAATGGTTTTTGAAATATTTATCAATCTTCAATTGAAA
TGCATTTTGGATTTTACATCAGGTGGCGCATGGCCTGAAATCTTCCCTAATTTTTAAATT
GGTGCCTCTGGGAGCTCAGTTTATACTATCAACCTGTTTAGAGATATGACATTTTATAAA
ATCAAGCTGAGTGACTCAGAATTATAATCAGTAATGCAAGAAATTGGAGATGTCAAAACC
CAGAAACTTAATATGTTGAGATACTTCAAGCTGCATAAATAGTTAAATAGATAAATTCAG
CAAGACTATTCAATATATGGGAGACATTTAAGAACAAATATTAATTGCAAGTATGTGACA
GATCCTGACATGGAATCCTAAATTTAAGAAGCACTTATTAACAAGCCAAAGAAATACATG
GTCTTAACAAATCAAGCAGCAACTGATATCTAAATTTCAAAACCCCTGCATCCAACAATT
TTTTCATCCTTTTCAGTTGAACTCTGGATATAATTTTAATCATTTCCAAGTTCAAGTGTA
ATTTTAAGAGATGACAGCCCTATACCAGGAAATACATAAGAATCAGACAATTTTTAGATA
AAAGCAAGTTCAAATAATATTCTTGATGTAAATTTGTACACTTCTACTTTCCTAAGTCAA
CCTAGTTTTACGAGTAGTTAAAATTTATATCCAAGTGTTGGTCCAGCTTGGAGACACATT
TATTTAGGTGTTAATACTATAAGTAAAGAAATTCAGGTGAGCTTGCAGTTTTCAATGACA
ACACATTCAGAAGCTGCTTTGACTTTTTGTCCACTTCTAATAAGTTACTGGAGATTAAAG
CCCTATAATGATTACTAATCTCTAGAAGATACTTCACTTAATCAATAATTTAGAAACTAA
GCAAGTGCATTAAATTATGTCTACGATGAAACATTCCCAGTCATCTGCACAGTCGACCAT
ATTTATGATGAGTCAACTAATTCATGTATAACAAAGGTCAATAGTAAGGAGAGAATCTTC
ACAATTTCAAGCAGCAGCACAGCCCTTGTTCATTTAGACACAACTAACATAGGCCCAGAT
TATTTGTTAGAATTTTGGTATTACACGAAAGTTGATGATTTCACGCTTATCGAGCATAAT
AAGTTTACAGTAAGCTTATCAAGTGGCACACAAGTGAAACTTACATATACAAGTAACAGC
ACTACTCTGCCACTTGCAATAAAACATGATGTTACATAGTGGAATCATTTCTTAATTTTA
TTTTCATCAGGAGCTTAAGACTATATAAATGCCACCTTCAGAATAAAATTCACTAAATAT
TATAAAGAGTTTTTCAGGTTAGATTTGCATAACTACGTCCACTATTATAAGAACAGAATC
TATAATAACTACGAGCTCGCACCAGGGCTGAGAGACTACTTAAGATTTGTGAAAACTACA
TCTGCTTTAAACTCTGTCGATTTTTAAATGCATTATGCATAAAAGACTAGTGGAACTCAC
CCACTACAAATAAATCCATCAGCGACTATCGCAACAACGAGAATTTCATGGAAAGACAAT
CTGCAGGAGTGTGACTTAGGCTACTCATTTAATGGTATCGTATGTAAAGCCAATTCAGCC
TCGATTCGAGCTATTCAACCTGCTTCTCTACAAATAAGTTAACTTAACTCATCTGCGAGT
CCCATTGACTACTTTTAAATAAGTTTCCACTTTCGCTTAACAGAAAGAATAATGAGTCTA
GCTTATTCCGGTGTGTGTATTCACTTGCAATCAGCTCCTACATACTTAGGCGGTAAAAGA
TTCATAGAATTTCAATCCTCAGCGGATTAGGGCTTTTTAATTTCAATTGCTGGCGCAAAC
ATGGTTTATTCTATGACAAGTAATTAATATTTTAAAGCCAACCACTGGTATAGCTTTTTT
AGTAAATATTCTGCGACCTCCTCAACTGTTTTTAGATCATTTATTGCTTATGATTTTAGA
AGTTTAATTGGTGAGTATGAATAAGATACTGGTAACTCTACTATATCCTTAGATAACTCA
ATCAATCACCAAATATATTTTGGCTATGCTAACACTCCTCAAACTCCCAATTGCGACCCT
GATTTCTCTATAAGAGATTTCTGGCTCTCCTAATAGAATAATCTATCATAAATAACACTC
TCTCAGTTTTTAAATGGCTTGAGAACTAGACACTAAGCTTTATAAGTATCCTCTGTGTAC
CTCGCTTTCAATGAGAGTGAAGGGTACCTAGTATATGATTATAACAATCCAAATCCTATG
TTAAATTTGAGAAGTGGAAATAATTTTATTGCATGGGAATGGGATCCAATTTTGTTCAAG
ATGTGTGATGGTCCTTATGAAGTTTATTACTAGTATCAATAGTACTACTGTGGAGTGAGA
TAATTCATGAGGTTCAATAAAAATAATCATCAAATAACTATTGGAGATTTATCCAGAGGA
GCATAAAACCAAATAACAGACACATACACATTTTCAATAACTTTTCACTTGAGAATTTAA
TCAGATGCCAACGTCCCTTAAACTCAGATATTTATACTTAACCCCACAAACTCAGGTGGC
AATTAGATGATATTTAATTTTAACCACAAATATTTACCTGGGGTTTATTACTATTGTCAA
AATGGAATAGATTTCCATGGGTATTAGAATACAGTGGCAAGCGACACTGATTAAGTATGC
AGTCTAATTGTAAATGCATGGGGATTGATTACAGTTATAAAGGATGGGCTCACTTATAAA
TTCTACTGCAATTATTATTTATACGCAAGCTACACTGTCACTAACTCTATGTTTCCTTTC
AATTTTGATGATAAGATAAAGCTAGGGGGTTCAAGTCCGGGTTATCAAACTATGAATGGA
TATATGAGATAGTTCAAATATTATGATGATTTAGTTCTCTCAACAACAGAAATCATCAAT
GACTATACTCTATACCAAATGGTTCAAGCAAGTTCATCTATATACTACTCACTTGAAATC
CATAATCAAAAGTACAATTTTTATCTAATTTACAATAAATTTAGTTACATGATAATGAAT
GAGGGACTTATTAGAGACAATTTGATTTAATAGCAAGATGATACCAATTATCCTCATTTA
GTACCTTTTAATAGCTTTGATACAACTGGATACTACTATAATTAGGGAAGCACTTACAAA
TGGTTGTCTACTACAGTAATTAGCACTTTAACACTTTCTGGAGGGAATGAGTGGACCCTT
GACATGAGATTAAGTCTCTAAGATTCACTTTCATAAGATTTGTTCCACATCAATGGATTT
ATTTATCTCCGAGGCTAATCAGATAGAAAATTAAGGATAATTTTAGGCTCAAATCCAACT
GCCTATATTACTAAAAATGCATTGATAAATTTAGACTAATATCAGCAATATGTATTTATC
TAAAGAATTGGTGGTACTGGAGTTACTTTTATTCTTGATGGTATAATTTAGGAGTTGATC
CCTTAAACAACTTCCCTGCCTTCTACGCCTGTCGCTTTGAAAATGCCTAATAATGATGTT
GCACTCAAAGATATCAGAATTTGGAACAAAGCCATGCCTTACAATTTTGTAAATTAATTA
TAATAAAAGATCATTGATGGAACATACTATCCAAATTTACTATATTACTTCATTAGTAGA
ACTCCAGAGCATAGATACTTCTTCAAATTTTTCAGATAGGGTTAATACAGTTATGAATAT
CACGGCCCTTATTCTTCTGCTCCATTTTAAGATAGTTATTTCTGTCTTGACTATTAAGTT
TTCGATGGATATTCATGTCAAACATTCAAATATGTTGTGTTGGATTCCACTAATTTTAAA
GATTTAGTCTTGAAAACACCTCAAGCTACACACATTTTGACGCCTACATCAGTAACATTA
GAATTTTGGATACTTTTACATGAAACTAAAAACGCTGGTTAAATTGTGACAATCATTGAT
ATTAACAATGTTGCAATGACATTATAAGAAAACAGTTTATTTCAAGTCACAGTATAAACA
ACTGGGCCAGCGCAAATAGTCTCAGATCGATCCAGTGCAAGCTCAATAGATGATTTTAAA
TATACTTATTGGAGAAAAGTTGTTATGTACGATTCATTCTCTGAGACCTTAGTTGGAACT
ACCGTACCAATTGCTAGGTTTTACATGTCTAATTAACCAGTCATTCTATAAAATTAATTG
AGCTATACTATGAGTAAAGATTGGAGCATAGATTTCTGGGTTAAATATGGTTAAAAGTCT
GGTTGTGGACTAAATTCAATAAACATTTTGAGTCAAATGGACGATGGTATATGCACAATT
GGAGATAGTAATGCTGCTAGAATAAATATTATGATTAATAAAATTTCAGGGTAAAGCAAC
TAACTAATTACTGAAGATCTGTAAAATGGAACAGTACCTTAAAATATCAATTAATATAGA
ATAGTGTCTTAAAATGTATACTTCCATGTTGCTATAAGAAACTCGCAAATCTAAGTAATA
TCTACTCTAAATTTTACCAATCCTATCATCTCACAATCGTTTAACCCCTTGAGTAAATGC
TCTTTTCAAATAGGGTATTCAACCTTACCTCTTGACTCTCATGTTTACTTTTAATTAAAG
AACCTAAGAATTTGGAGCTCAGCTATGACCTTAGATCAAATTATGATGTGGTCTACATCT
ACAATTACAGAATAAGGTTTTACAGATCTAGTAGCTTATTATAAATTTGATAATGAATAC
TTGATTGATGCTATTTCTGGGTAAGCAAATGTATAATCCGCATTGGCAACATTTGACGTA
GTGGCAGATAATGAGCTAACTATGAATTGCCCAATAGGCTTTGGCTTTGATTACGATAAG
AGAAATTGTTACCATTTGGATCACCAAATGTTATTTTACTACTAAGACTCAAATTTTACA
TGGGATTTGTAGCCATATATTCAAAATTCGATAAAAGATGAGGATTTATCTTTTACAGCC
TATTTTTATATCTGGAATTAGCATTAAAACTACACTTTTAATGTTATTAGGTTCTGTAAT
ATCTTTCAACTATACTGGAGATATAACACTTACACTTTGAAGTTCAGCTGGAATGATGCA
TCCTTTGTGTCTTTGCCAATAATTTAAGGAGCAAGTACAACTTATTATAACTGGTTTATT
ACTTTCAATATGGAAGATAAGTAGCTCTTAATTGTGAGAAATGCAGATGTTATTTTTGAT
TTAACAATATCTTAAGATGACATACTTTAATTTGCAAATATTTCAGATTGGAAAATGACC
TACGGATATGTTAATGATATAGATGAGTACCCAATTTAAGGGTTTAAGCAAGCTAGTTTA
TTTCAGCCACCTTTAAGTTACTAAGAAACTTAAATGATTCACTCGAGGTAATAGCATAGT
CAATTTATGGGATAATATGGGTTGAAGCAAAATATTAGGTCAGAGTATAATTATGCAATA
TACAATTCAATATTTAAGACTAGCTTATATGATTAGGGAATGAAAAAATATATAACAACT
CAATCGGGCACTTAAATTGATAACGCTCAAGAATCTATTTGTTAACCTGGAAGTAACAAA
ATATAGATTTTCTGCGTGGAAGCAAGTTCATTAACAATTTAAGGTTAAATTTTGTCATTA
AACGCCACAAGCATTTTAATATCTAGGCAATTTACTTTTACAGGCTGGTTTTATATTGAG
CATCATGATATAACAAGTTCAACTATAACTTTTGCCCAAATTGACTCTCTATTCAGTCTC
GAATACACTTCTTTTATTACTCTTAAAGCTTATTAAGCCTTAATGAATTATGATCACACT
TCATTGGCTTTGAGCAATAAATAGTGGTATTACATGGTTGTAAGCTTAGATAATTTGGAT
TGGAAAGTATAACTAAACGAATAATTGATTATTTAACAGTAAGGTCAAGATATTGATTAT
CAAACAACACCTGTTAATGAAATTAAAATTGGAACTTCTTCTTTAAAATCAGTGATTTCA
GTTAAAGAACTAAAATTGTTTGGTCACTCTTTAGATATTCTAGAATTGAGAGAAAATATG
TACACTCATACAATGAAAGACAGCTACTATAACTAAATGATGGTTTATTATCCATTAGCA
GAGACGGGTAGAAATATTATTTAAGACATATCTAAAGAAAGCAGGTTAACCACTATTCCT
AATTAGCAAGGCATATTTTGGAGCTATGTACCAAGAGGAGAGATTTCAACTAATTAAAAT
GCTTTAGCTAGTGTGTCATCAGGAAAGAATGCATACATTACAAAAGATAAATCATTGTTT
TTTGAAAAAGGAACTTCAGCTTAATATGTGCTTGGTTAAACAATTTTAAGGACGAGATTT
ACAATTTCACTTTTTGCTAATTTCTAAGATTTTACGATATTTGCAGTGCCATAAACATTT
TTGAGTTTAAATCCAGGTCTATTGCAAATCAGAGTTTCATCAACCCAATTTCGATGTCTG
ATATCAGATGACACAAGTTCACTCTTTGCAATTAATGGCCCTACAAATTAATGGATTGGC
TTGATATGCGGAATATCAGATTCTCTTAAAAGCGGGTATTTTTACTAATTTTAGACTCAA
CTTATCGATGGTATTACAATTAGAGATACTTTTACTCCTTCTCCTTAAGCTTTCCAGATA
AATCAATTAACTATTTCTGGATTTGATGGATATTTGAAGGAAATAAAAATATTTAGTGAG
CTAATAGATCCTCATGTTATGATGAAATATTCAAGGCAAGTTAACTATCCTGATTATAGT
GGAGTTCCCATGCAGTTTTACATAAGAATAAATGAAGCTTTTGGTTAGAAAATTTATGAA
AGTGTTAGTTAGTAGGATGTAGCTATTCAAACTAGTATTGCAGGAGTTTTTCCATATTGG
TCAAAGTCATCATAAGAATTAATTATATGTGAAGGACACTCAAAATACATAATGTAATAT
GATTATTGTTAAAGAGCTGAGAAATTCGCAAAAATAGATCCAGCTTTTCCTTTTTCATTT
ACAATTGCTAAAGATGAAATGCAAAACTCAACAACACTAGTATGGGTTTTATTTAAACAT
TTTGGATACGATCCAATCTCCCTCGAAATGTCACTTTAAGAAAGATTTACTTGGAGCATT
ATGAAAAATAAAACTGGAGCACTGCTTCTAGCAAATTCATCTTATAAATTGTATGGAAGA
AGAGATGAATCTGATATAATCTCAGGAAAGAAATGGGTATTGTTTATAAATAGAATTATT
TATCCCTAAGGTGTAGTCCATAATTATCTGGGAAGGCCTACTTAAATTTCTCAATCTACA
ACTGACATAGAGTTAACTGGTACTCTAAACACCAACGCCAAACTTTTGTTTACAAATAAT
ACATCTGGCTTACTTTTCTAAATATTAACTGGGACAAATTCAGAAATATTCTTTAGAAAT
TTATAACTTTGGAACTCAGTATTCACTCTCGATGTTGCTAAATAACGAGCAATTAGAGGC
GCAAATCCTTACAGATTTGCAGATACATTAGTTGCTTTATTTAGATTAGATGAGTCAGGA
GGAGATTCATTATTTAATACTGCAAGTTTTTAAAGAGAGAGTAATCCAAGATTAATATAA
GATCCAACTAGCAGTGGTACAAGTGCTGGATTACTTCGATGGGTTTACTACAAAGAAATT
GATGCAAATCCTACAACTGATTCAGAAAACTACAAATGTCATGACGATTGCGTAATCGAT
GATTGTATAGGTCCAGCATTAGACGAGTGTATAAATTGCAATTAGACTGGATAGTAATTA
ATTCTACCTGATCCATTGGACTGTGTTGGTTGTTCTAATTTGCTTTGTATATGCCCTGAA
GATAATCTGACAGCCTGCAGTGAATGTGCAGATCCCTCAAACTATTACATCTTGAAAAAT
TAAACCTGCATAACTGGATGTCCTAACAACCTTACACAATTCTATGACACTTAATTTTAA
GATTGCTTAAAATGTCATGCTTATTGTTTAGGATGTACTGGTCCAACTAATGCTGAATGT
ATAAATTGCAAATCTCCATATTTGAGATTTGGGTCAGTATGCGGTTCTGCAGATTGCCCA
ACTAATGCATTCTTCGATTATAATATATTTGAGTGCGTTACTTGTGAAAGCCCATGTGAA
ACATGCATTGGAAACCCCTATAATTGCATTACTTGTATAGAAGGATATGCCTTTGACAAT
GATGGTCTTTGTACAAGATGCAGTGATTTAATAGGATTTTTCGAGCCTTGGTATAAAAAA
TATACAGTTCCTGGAGGAGGTGTATGCACAGAAATATGTGGAGATGGTCTTGATTTCTAA
AATTACCCCTGTGATGATGGAAACCTGAACAGAGGGGATGGATGTGATTAAAATTGTAAC
ATTGAGCGAGATCATTCTTGTGAAGGAGGAAATATTATGAAACCAGATTTTTGTTTTGAC
AATAAAGGGCCAGCATTTTCAATTGATAAAATATCTGGAAAAGAAGGAAACTTAGAATTT
GATGCTAACAGTGCTGTTACAGATATTCTTAATGATAGCGGGAAAATCATAGTTAGTTTT
TCTTAATAGTTTTCAATACTTGAGGAGAAAACTGTTTCAATTGAGATCGGTTTTAAAAAC
AAATCGGCTTTCAGAGATGAAAATGGGAATCCATTAAGAAATTAAATCTCCTAAGCATAA
TATCTAGGAACTTATGAATTTGTAAACTCTGAATAAGAAGCTTAAGCTAGACAACTTGGT
TAAACAGCCTCAACTACTTCGCTATTAACAATGATAATAAACTTCGTAATTCAAAACCTA
CTAGGCAAAGCTCTCGGAAGTATTTGGGTTGCAATGAATTCTTGTTAAATAATTTATTAC
ATGCCACTCATGGCAGTTCCATATCCTAAGCTTTTGAAAGTGTATTTGAAATACCTCGAT
TTTGCAAATGTTTAAGACGATTTTATGGGAAAACCATTCTTCTATAAATATCTTTATCTA
AAATAAGTAAAAGATGAGCCTGTAAATGAATCTTACGAGGACTATGGCTTTGAATCATCC
ATATTTTTCTTCTCTTATGCAAATAAAATTCAAGGTTGGGGTATCTTGATGTGTGCATAT
CCCTTAATTTTGCTTGGTTCTTATGCTTTAAAATTTAAAGCTTTTGACTTTTTAAGAAGA
ATAGAAAAATCATACAGATTCAACGGCTTATGGAGGCTTTTAACTGAATTATATTTAGAA
ATGACACTTAATGCTTTTATGAATATTTATTCTTTGTAATTTGGATCTAAAACCCAGCTA
ACAATATCGGTGATGGCTTTGATTTTTATGGGATTTTTAACTTATTTGCCTGGTTTCACT
TTCACTATCATTAATGCAAATGCTCATCGATTTCAGTAAAAAACTACAGAGGAAAAGCAT
GGAGTTCTTTATGAAGGTACTAGGATCGAGGAAAATAAGTCTATCAATTAAATGTATATA
CCTATTTTCTTATTTAGAAGGTTGACCTACGTATTCATATTGGTATTATTAAAAGATTAT
CCAACTTATTAGCTAACGGCTTGTGTTTTTAAGAACTTTTGTTATTTAATGTTCTTTGTC
ACTTAAATGCCATTTAAGGAGAAAATGTTGAATTATCAACACATAATGAATGAGACCCTG
ACTGGTATAGCTTTTGCAGTTTCCTTTGTATTTACTAAAACTTCAACGTAGCATGACCTT
GATTTTTATTCAAACATGATTCTGGGAGTTGTTGTATTAATCCTTGGTTTTAATTTCTTA
TTGGTGGCTTTTGATACACTTAAGGGAATAGTTGAACTTATTAAGAATTTCAAAGTCAAA
GTTTAAGGATTGAAGGATAGAATAAAAGCCTTGATAAATTTGCTAAGAAACAAAAAAGTA
GAACTTAATGAGACAACAGAGAGCAGCTAGAATGTACTATAATAAAATGGCTATAAGCCT
AATATAAACACAAGATTTGATTAATAAATTTAAGGAGATTTTGAAACACAATAAGAAGAC
GAATAATTTCATAATATTTCGGGTTAAAGAGGAGGCCATAGAAAATATGAAAGGTTAAGA
GGGTAAATGATACTCAATAGTGAGTAAAAAATGATACCCAATAGTCCACAGTCTGTTTTA
ATGATTCAAAAGAGAAGGAAATTACTATAGCAAATGCAGGATGGGCTTTAAGATGGAGAT
AATATAATCAGCAATAAAATTGGCACACGAATGAGACAGATGAGTGCTAATTATTACAAT
AATGATGAATTCTATCCATAAAAAGATGCATTTAAAGATAATAGTAGAGTTCTCTAATAA
AAAAGTGGAAAATTATAGGTTAAACTATTAAATACCAAAGATCAATAATTAATGAATGAC
TACGTTTCTCCCTAGAAACATTTAAATATAGGGAAAGACTTAAATTCTACAATTAACCAG
AATAATACACAAGAGAATTTAATGTTTAATATTCACGGAAATCACTTGAATGAATCAAAA
GATGTTAAAGATCTATTATCAGAAATGAAATATGATGATCGTAACAATGATGACGTCTCG
TTTGAATATCTCAGAGGAGATTTGAAATTGAAGAGGAAATTATAAAATCAATTGAAAAAT
AGGATTGATATGAAACACTGA


>Contig20746.0.g28(protein)
MDITLSSVPLCRSSYFQYIYPFNQADLGSDDLAYTMNIWWKPISFESEQLFFQFGTQILQ
LGTEEYTGKMYFTAGGLQSNNTSIISGPLNPIYPQFNQWQFLSVRKSPMVFEIFINLQLK
CILDFTSGGAWPEIFPNFQIGASGSSVYTINLFRDMTFYKIKLSDSELQSVMQEIGDVKT
QKLNMLRYFKLHKQLNRQIQQDYSIYGRHLRTNINCKYVTDPDMESQIQEALINKPKKYM
VLTNQAATDIQISKPLHPTIFSSFSVELWIQFQSFPSSSVILRDDSPIPGNTQESDNFQI
KASSNNILDVNLYTSTFLSQPSFTSSQNLYPSVGPAWRHIYLGVNTISKEIQVSLQFSMT
THSEAALTFCPLLISYWRLKPYNDYQSLEDTSLNQQFRNQASALNYVYDETFPVICTVDH
IYDESTNSCITKVNSKERIFTISSSSTALVHLDTTNIGPDYLLEFWYYTKVDDFTLIEHN
KFTVSLSSGTQVKLTYTSNSTTLPLAIKHDVTQWNHFLILFSSGAQDYINATFRIKFTKY
YKEFFRLDLHNYVHYYKNRIYNNYELAPGLRDYLRFVKTTSALNSVDFQMHYAQKTSGTH
PLQINPSATIATTRISWKDNLQECDLGYSFNGIVCKANSASIRAIQPASLQISQLNSSAS
PIDYFQISFHFRLTERIMSLAYSGVCIHLQSAPTYLGGKRFIEFQSSADQGFLISIAGAN
MVYSMTSNQYFKANHWYSFFSKYSATSSTVFRSFIAYDFRSLIGEYEQDTGNSTISLDNS
INHQIYFGYANTPQTPNCDPDFSIRDFWLSQQNNLSQITLSQFLNGLRTRHQALQVSSVY
LAFNESEGYLVYDYNNPNPMLNLRSGNNFIAWEWDPILFKMCDGPYEVYYQYQQYYCGVR
QFMRFNKNNHQITIGDLSRGAQNQITDTYTFSITFHLRIQSDANVPQTQIFILNPTNSGG
NQMIFNFNHKYLPGVYYYCQNGIDFHGYQNTVASDTDQVCSLIVNAWGLITVIKDGLTYK
FYCNYYLYASYTVTNSMFPFNFDDKIKLGGSSPGYQTMNGYMRQFKYYDDLVLSTTEIIN
DYTLYQMVQASSSIYYSLEIHNQKYNFYLIYNKFSYMIMNEGLIRDNLIQQQDDTNYPHL
VPFNSFDTTGYYYNQGSTYKWLSTTVISTLTLSGGNEWTLDMRLSLQDSLSQDLFHINGF
IYLRGQSDRKLRIILGSNPTAYITKNALINLDQYQQYVFIQRIGGTGVTFILDGIIQELI
PQTTSLPSTPVALKMPNNDVALKDIRIWNKAMPYNFVNQLQQKIIDGTYYPNLLYYFISR
TPEHRYFFKFFRQGQYSYEYHGPYSSAPFQDSYFCLDYQVFDGYSCQTFKYVVLDSTNFK
DLVLKTPQATHILTPTSVTLEFWILLHETKNAGQIVTIIDINNVAMTLQENSLFQVTVQT
TGPAQIVSDRSSASSIDDFKYTYWRKVVMYDSFSETLVGTTVPIARFYMSNQPVILQNQL
SYTMSKDWSIDFWVKYGQKSGCGLNSINILSQMDDGICTIGDSNAARINIMINKISGQSN
QLITEDLQNGTVPQNINQYRIVSQNVYFHVAIRNSQIQVISTLNFTNPIISQSFNPLSKC
SFQIGYSTLPLDSHVYFQLKNLRIWSSAMTLDQIMMWSTSTITEQGFTDLVAYYKFDNEY
LIDAISGQANVQSALATFDVVADNELTMNCPIGFGFDYDKRNCYHLDHQMLFYYQDSNFT
WDLQPYIQNSIKDEDLSFTAYFYIWNQHQNYTFNVIRFCNIFQLYWRYNTYTLKFSWNDA
SFVSLPIIQGASTTYYNWFITFNMEDKQLLIVRNADVIFDLTISQDDILQFANISDWKMT
YGYVNDIDEYPIQGFKQASLFQPPLSYQETQMIHSRQQHSQFMGQYGLKQNIRSEYNYAI
YNSIFKTSLYDQGMKKYITTQSGTQIDNAQESICQPGSNKIQIFCVEASSLTIQGQILSL
NATSILISRQFTFTGWFYIEHHDITSSTITFAQIDSLFSLEYTSFITLKAYQALMNYDHT
SLALSNKQWYYMVVSLDNLDWKVQLNEQLIIQQQGQDIDYQTTPVNEIKIGTSSLKSVIS
VKELKLFGHSLDILELRENMYTHTMKDSYYNQMMVYYPLAETGRNIIQDISKESRLTTIP
NQQGIFWSYVPRGEISTNQNALASVSSGKNAYITKDKSLFFEKGTSAQYVLGQTILRTRF
TISLFANFQDFTIFAVPQTFLSLNPGLLQIRVSSTQFRCLISDDTSSLFAINGPTNQWIG
LICGISDSLKSGYFYQFQTQLIDGITIRDTFTPSPQAFQINQLTISGFDGYLKEIKIFSE
LIDPHVMMKYSRQVNYPDYSGVPMQFYIRINEAFGQKIYESVSQQDVAIQTSIAGVFPYW
SKSSQELIICEGHSKYIMQYDYCQRAEKFAKIDPAFPFSFTIAKDEMQNSTTLVWVLFKH
FGYDPISLEMSLQERFTWSIMKNKTGALLLANSSYKLYGRRDESDIISGKKWVLFINRII
YPQGVVHNYLGRPTQISQSTTDIELTGTLNTNAKLLFTNNTSGLLFQILTGTNSEIFFRN
LQLWNSVFTLDVAKQRAIRGANPYRFADTLVALFRLDESGGDSLFNTASFQRESNPRLIQ
DPTSSGTSAGLLRWVYYKEIDANPTTDSENYKCHDDCVIDDCIGPALDECINCNQTGQQL
ILPDPLDCVGCSNLLCICPEDNLTACSECADPSNYYILKNQTCITGCPNNLTQFYDTQFQ
DCLKCHAYCLGCTGPTNAECINCKSPYLRFGSVCGSADCPTNAFFDYNIFECVTCESPCE
TCIGNPYNCITCIEGYAFDNDGLCTRCSDLIGFFEPWYKKYTVPGGGVCTEICGDGLDFQ
NYPCDDGNLNRGDGCDQNCNIERDHSCEGGNIMKPDFCFDNKGPAFSIDKISGKEGNLEF
DANSAVTDILNDSGKIIVSFSQQFSILEEKTVSIEIGFKNKSAFRDENGNPLRNQISQAQ
YLGTYEFVNSEQEAQARQLGQTASTTSLLTMIINFVIQNLLGKALGSIWVAMNSCQIIYY
MPLMAVPYPKLLKVYLKYLDFANVQDDFMGKPFFYKYLYLKQVKDEPVNESYEDYGFESS
IFFFSYANKIQGWGILMCAYPLILLGSYALKFKAFDFLRRIEKSYRFNGLWRLLTELYLE
MTLNAFMNIYSLQFGSKTQLTISVMALIFMGFLTYLPGFTFTIINANAHRFQQKTTEEKH
GVLYEGTRIEENKSINQMYIPIFLFRRLTYVFILVLLKDYPTYQLTACVFKNFCYLMFFV
TQMPFKEKMLNYQHIMNETLTGIAFAVSFVFTKTSTQHDLDFYSNMILGVVVLILGFNFL
LVAFDTLKGIVELIKNFKVKVQGLKDRIKALINLLRNKKVELNETTESSQNVLQQNGYKP
NINTRFDQQIQGDFETQQEDEQFHNISGQRGGHRKYERLRGQMILNSEQKMIPNSPQSVL
MIQKRRKLLQQMQDGLQDGDNIISNKIGTRMRQMSANYYNNDEFYPQKDAFKDNSRVLQQ
KSGKLQVKLLNTKDQQLMNDYVSPQKHLNIGKDLNSTINQNNTQENLMFNIHGNHLNESK
DVKDLLSEMKYDDRNNDDVSFEYLRGDLKLKRKLQNQLKNRIDMKH