Identifiers and Description

Gene Model Identifier

Contig20733.0.g18

Standard Name

None

Aliases

Contig20733_0_g18

Description

Chitin synthase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL192W2.0008958828286524e-54CHS1 SGDID:S000005136, Chr XIV
from 276502-279897, Geno...
T. thermophilaTTHERM_005999401.9998745702418095e-48Chitin synthase family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20733.0.g18(coding)
ATGGCGACACCTACATAACAGAATTAAGCGCCATAGTAAATCTAGAAAAAGAGTTTATTT
CTTAATAAACCCATCGAATATGCAAATTACAAGCAAGGTGGTAAGGTTGATGAAGAATCT
AATCTTCTACCAACTTCTAAGGCAGCTGACTTTGGACCAGGACATTTTGATGTTGACGAC
AATGAGACTATTGACATGTCAGTCATGAAAGTTGATACCTGGAAACCTGCCAGACTTCAT
TCTTATGAAATTATGGGTTTAGCAGATTCACAATTGAACTGCAAAATTCGTCCATGTGGT
TTCCCAAAAATGAAGACAAATTGTAGATTGAGAGGTACAAATCCAAAACTAGCTGTGTGT
ATAACTATGTACAATGAAGACGAGCAAGAACTTAAAAATACTCTTTCGGGTCTCCTTCAT
AACTACAACGAGATGCGCATTGACCCAGACCTATAATTTAAAAAGTAGGATTTCATAGTG
TTCTTGATTTGTGATGGTTACGATCGTATACCTGAATCTTTTAGGAAATATGCAACAGAG
AAACAATTCTTTGATGAAAGTATCATTGAAAAAGGAGGCTACATGGTAAGAGATAGATCA
GGAAAACTAAAAATGAAAGATATTGCTGATGTAATGGACGATAATGTAACAAAAGTACCA
CTAAACTTTATTCATATGTTCATGGTACAGTCGTGGGATTTTGGATTATAGGAGGATATC
TTGAAGGGCCGCAGAATTAACTTTGTTTTCGCTATTAAACATAGAAATGATGGAAAAATT
AACTCTCACAAATGGTTCTTCTAAGGTCTTTGCAAGTATATGAAGCCGGAGTTATGTCTT
ATGTTAGATATTGGTACTCGTCCAGATAAGCATGCAGTCTTCAAGTTATACAAATACATG
ACTAAGCACAAAATGTGTGGTGGCTGTTGTGGTGAAATCGAAGTGGACTTTTCTAATGAC
AGAGACATATCTAGTGCTTACTTTGTGAAGGCAGCTCAATTCTTCGAGTATAAAATGGGT
CACTCTCCAGATAAGGCTTGTGAAAGTTTCTTCGGTTTCAACTCTGTGCTACCAGGAGCC
TATTCTTTATTCCGTTGGTAAGCCATTAGTGGAGAGCCTCTAGATTAATTCTTTAAGAGT
GTTACCAGAGAGGACTTACCATCTTGTGCAGAAGCTAATGAGTTCTTGGCTGAAGACAGA
GTCATGTGCTTGCAGATTTACATCAAGAAAAACAGCAAATATCATTTGGCTTATATACCA
GATGCCAAAGCTTTTACAGATGCTCCAGATTCTCTAGCTGTTCTTATTAAGTAGAGAAGA
AGATGGATGAATGGTGCTATGTTTGGTACTGTTAAAGTCATATCTAACTTTGTACATATG
GTGAGTTGATCTATGTATGCTTCAATCACATTATTCCTTAAGCAAAGTTTTGGTAAACTT
CTAGAAACTGGCGGTTATTCTTAAACTTTCGTGCTCTTTGTAGATTCTTTCTTTGACTAC
TTCTACATAGCGATGATTATGCTTGCACTGATTACGTCATTAACAACTACTGTTGATAAG
GATACAGGCTTTTGGGCATAAGTATATAAGTACGATGATTCAACATGGCCATATTGGAAA
CCAGTAGGAGATGAACACCATCTCTCACTCTTAGTCGTCGCTGGTACTGTAATGTGCACA
GTTTTTCTGATGCCAATGATCCTACGTCCATTTGATTTTCTAAGTAACGTGAGAAATTAC
ATAATGGGTTTGATATCTTACCTGTTTATGATGCCTACCTTTATCAACATTATGCAGATT
TATGCGATGTGCAACTTGCACGATATCTCTTGGGGAAATAGACCCACTACTCAAGGCATG
GAGGCTGTAACACATAACGCTGTTGCTTAGGAATTGCTTAAGCAAGACTATTAGTTATTT
AGAGCTCATTTCTTATTCTTTTGGTTGATATCAAATGCGGTATTTGGTGGACTAACTGTA
TTTTTAAACACTGGCTCTAATGTGTAATATCTTAATAGAGACATAACTTTCCTGGATGGT
TTCGCTTTGTTCGTGGCATCTCTTGTATTTTTCAAGTTTATTTTCTCACTTATTTACATT
ATGAAGTGGAATTTCAGATAGTGGACTGACCCATACTACAGAAAGAGTAAGGTAGATGTT
GCTGATAACTTCAAAGCAATGAGAAAGAGACCAGATTTTGCATATAGTTCAGACGAAGAT
GATGATATAGACAATCAATTATACAGTGTCAAAGATAATGGATCAATTTTGATCAGGAAC
AATGAAGGAGATATATTAGATGTGTAGCAAAACAACCCAGAGATAGATGATTCAGACAAT
GACGATATGGAATTCGATGATGATAACGATGAGGATATTGGTGATTTGTATGAGCAACAG
CAATTAGAGAGATCTTACAGAAGTATGAGCAAATACAGAAATATTTACCCCAACAAACCC
AGTGGAAGCGGCAGCGGCTATGCAAAAGGCTTCTAAAACAAAGCAAATCATTCTCAGAGA
ATTCAGCCAGACGCTAAGAATCAACTCCTAGAGTAGCATCAACGTCACCTGGATACATCT
CCCTTGGTAACTGACAATGATGACACTGGCAAAATGGTGATTGAGAGCGCCATATCATTT
GATCATGATAATCCATATGTAAACAGAGCAGGTGGTAATAAGACAAATTCATTTGTTCTA
CCTAAATTTGGTAGATAAACTGGAGAATTGATCAAACAATTAAACTTGAATAATCTAGAG
GGAGAACCTAGAACAAGCTCATTAAAAGTTGCTTTATTAAATAAAAATGATCAGCAAAAC
ATTTCGAGTAGTTTGAGAAAGAACTCCAATGATAAATCTAGACTTGATCAGTCATCTTCC
ATAAGAAAGGCAGTGAGATTCCAAGACCCAAACAAAGAAGTGCAGAGTTTAAGCAGACAT
CAAAGCTAAAACGAGCAAATTGTAGAACAGCATGAAGAGGAAGATCCATATTCCAGTTAA
TCAAAGATAATAGATGACCAGAATGTTGACTATAAGGATGATAGTCAAGCTTAAAAGAGT
TCTATCAATTTTGGTTTCGATAACTATAACTGA


>Contig20733.0.g18(protein)
MATPTQQNQAPQQIQKKSLFLNKPIEYANYKQGGKVDEESNLLPTSKAADFGPGHFDVDD
NETIDMSVMKVDTWKPARLHSYEIMGLADSQLNCKIRPCGFPKMKTNCRLRGTNPKLAVC
ITMYNEDEQELKNTLSGLLHNYNEMRIDPDLQFKKQDFIVFLICDGYDRIPESFRKYATE
KQFFDESIIEKGGYMVRDRSGKLKMKDIADVMDDNVTKVPLNFIHMFMVQSWDFGLQEDI
LKGRRINFVFAIKHRNDGKINSHKWFFQGLCKYMKPELCLMLDIGTRPDKHAVFKLYKYM
TKHKMCGGCCGEIEVDFSNDRDISSAYFVKAAQFFEYKMGHSPDKACESFFGFNSVLPGA
YSLFRWQAISGEPLDQFFKSVTREDLPSCAEANEFLAEDRVMCLQIYIKKNSKYHLAYIP
DAKAFTDAPDSLAVLIKQRRRWMNGAMFGTVKVISNFVHMVSXSMYASITLFLKQSFGKL
LETGGYSQTFVLFVDSFFDYFYIAMIMLALITSLTTTVDKDTGFWAQVYKYDDSTWPYWK
PVGDEHHLSLLVVAGTVMCTVFLMPMILRPFDFLSNVRNYIMGLISYLFMMPTFINIMQI
YAMCNLHDISWGNRPTTQGMEAVTHNAVAQELLKQDYQLFRAHFLFFWLISNAVFGGLTV
FLNTGSNVQYLNRDITFLDGFALFVASLVFFKFIFSLIYIMKWNFRQWTDPYYRKSKVDV
ADNFKAMRKRPDFAYSSDEDDDIDNQLYSVKDNGSILIRNNEGDILDVQQNNPEIDDSDN
DDMEFDDDNDEDIGDLYEQQQLERSYRSMSKYRNIYPNKPSGSGSGYAKGFQNKANHSQR
IQPDAKNQLLEQHQRHLDTSPLVTDNDDTGKMVIESAISFDHDNPYVNRAGGNKTNSFVL
PKFGRQTGELIKQLNLNNLEGEPRTSSLKVALLNKNDQQNISSSLRKNSNDKSRLDQSSS
IRKAVRFQDPNKEVQSLSRHQSQNEQIVEQHEEEDPYSSQSKIIDDQNVDYKDDSQAQKS
SINFGFDNYN