Identifiers and Description

Gene Model Identifier

Contig20717.0.g19

Standard Name

None

Aliases

Contig20717_0_g19

Description

Glycosyl transferase family 4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • phospho-N-acetylmuramoyl-pentapeptide-transferase activity (IEA) | GO:0008963

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000709901.9999366565375063e-113Glycosyl transferase family pr
otein
SGDYBR243C1.9993206333383003e-80ALG7 SGDID:S000000447, Chr II
from 706793-705447, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20717.0.g19(coding)
ATGACTTCAGACAAAACCCTGGCAGACTTGCAAGAGCGTTATAACATGGATGCAGAGATT
TGGTAGAACTCGAAGAGAGGATTCCCATTCAATATTCCACTTAACTTCGTAGTATTAAGC
GCAATTTGTTCACCTTTCGCATTATCAGTAATGCTCTTAGACTTTAGTGATAAGCATTTA
AGAGATGTTATCGTCGTCACTTTGATACTATCAATTCTGGGGTACATAGTTGCACATGCA
GCTATTAAATAATTTAAAGGTAATATGGAGACTAAGGGACTGTTTGGAATAGATCTTAAT
AAAGCTGGTAAAAGAGAGGAGAAACCTAAAGTTCCAGAGGCATTAGGTTTGATAATTGGC
ATTATATTCTTAATGATCACGATTCATGAGCAACTTTTACTTCCGACCAATTATAAGAGA
TTAGTAGAGTATAATGCAGGTCTTTTGTCTACATGCATGGCTATACTTTTAGGATTCGCT
GATGATGTTTTGGACTTGAAATGGAGACATAAACTCGTTGTCCCAACAATTGCTACTTTT
CCTATTTTGGCTGCTTATAATGGATTAACTGTTGTAGTCTTGCCTAAAATACTTAGACCA
GTAATGGGCAATACTTTAGACTTAGGTTATTTATATTATCTGTATATGAGTATGCTTGCT
GTCTTTTGTACTAATGCAATAAATATCTATGCTGGAATAAATGGAATAGAAGTAGGTCAA
AGCTTCATCATTGGATGCTTCATTTTCATTCATAATGTGATTGAAATTTATCTTCAACCA
ACACCTCAAAGCTATGATTAGCACATTTTCTCTATATCAGTGATTGTCCCATTCTTGTTC
GTGACTCTAGCTCTTTTGCAGCATAACAAGTTCCCATCTAGAGTATTTGTTGGAGATACT
TTCTGCTATTTCGCAGGCATGACTTTTGCAGTTGTTGGTATTTTGGGCCATTTCTCTAAG
ACAATGCTACTATTCTTTATACCTTAGATTTTCAATTTTATTCTGTCAGCTCCTTAAATC
TTTGGATTTATACATTGCCCTCGTCACAGACTGCCCAAGTTTAATCATGAAACCTATAGA
ATGGAAGCAGTCCACAACCATTTCACTAATATTAATGCTTTCTTAAGAGTGTTTGGACCA
ACCAATGAGCAACAAGCATGCAATTCCTTACTTATTGTCCAGATTTTATGCTGCACTTTT
GGATTGTTCATAAGATATTTTGTAGCTAGTTTATTATTTTGA


>Contig20717.0.g19(protein)
MTSDKTLADLQERYNMDAEIWQNSKRGFPFNIPLNFVVLSAICSPFALSVMLLDFSDKHL
RDVIVVTLILSILGYIVAHAAIKQFKGNMETKGLFGIDLNKAGKREEKPKVPEALGLIIG
IIFLMITIHEQLLLPTNYKRLVEYNAGLLSTCMAILLGFADDVLDLKWRHKLVVPTIATF
PILAAYNGLTVVVLPKILRPVMGNTLDLGYLYYLYMSMLAVFCTNAINIYAGINGIEVGQ
SFIIGCFIFIHNVIEIYLQPTPQSYDQHIFSISVIVPFLFVTLALLQHNKFPSRVFVGDT
FCYFAGMTFAVVGILGHFSKTMLLFFIPQIFNFILSAPQIFGFIHCPRHRLPKFNHETYR
MEAVHNHFTNINAFLRVFGPTNEQQACNSLLIVQILCCTFGLFIRYFVASLLF