Identifiers and Description

Gene Model Identifier

Contig20708.0.g67

Standard Name

None

Aliases

Contig20708_0_g67

Description

Eukaryotic aspartyl protease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPL154C1.9994920269952867e-34PEP4 SGDID:S000006075, Chr XVI
from 260931-259714, Geno...
T. thermophilaTTHERM_000822309.99723014177113e-33Eukaryotic aspartyl protease f
amily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20708.0.g67(coding)
ATGCTTAATCAACAAAGGCAAGCTGTTACGTTTTCAAATGTTGTTCTTTACGCTTTATTC
ATTGGAATTAGCCTAAACTTGGTATAAAGCTCAAACCATACCTCAAAAATGAATGAAAAT
TTGTCAGAATAAGTTGTCCCTGTACAATCCAAAGATTATATAGAGATTGATTTGCATAGA
AAGGAAGTGTTGGGGCCAAGTCGTCTAATGAAATTTAGAAATTCTAATTTGGAGTAAAGT
GGATTTAATGGTTCTAGACACCTTGAGGACTCTATTGAATTGAATATTATGAATTATAAT
AACATTTAATACTATGGCTATGTGTACGTTGGCACGCCAAGGCAAAGATTTACTTTTATG
TTTGATACAGGTTCCTCTTGGGTATGGCTTCCCAGTACTAATTGTTCAAAAGATGAATGC
AGCAAGGGCAGGTACAATACTTCAACTTCCTCTACATATAACCAGTTAGGCAATACAGTT
ACTATTTAATATGCATAAGGAAATGTGAGGGGTTATGTGGCATAAGAGACAGTCGTATTA
GACGAGAACGGGAAATTTAGCGTTACTGACTTCAACTATCTTTCTGTGTTTAGCGGAGGA
GATGTTCATACTCTAGAAAGTGACGGTTTGATTGGATTGAGTGTGTCAAAGATAGGATCA
TAGCTACAGGATTTATTTGTGCAAAAACTATTCCAACAGAAGAAAATAGGAACATATGGC
TTCACAATGTTTATTGGTTCAACTAAGCAGTAATCAAAGCTCTGGATTGGAACATACTTG
CTGCCCACGACAACATAATATGGAGATCTACAATGGATTAAGTTATCATCTAACTATCAT
TGGTAAACTAGTTTGACAAACGTGATTATTAATGGTCAATAAATTCCTCTTTCTAAAAGT
AAGGATGCTATTTTGGATTCAGGTACTTCACTTACTTATATTCCAGCTGATGAATATAAT
GCGATTTATAATGCTATAACAAATGGTAAGAATTGTTGGATTACCTAGGGATATCAATTT
TGTTCTTGCAAGAATTCTGAAGACACAAGTTATCCTATTATTTATTTCAACTTGGGCGGA
GTTCAATTCAAAATGCAGCCTTTTCAATACTTACAAACTTATTCTGGACTATCTGGTTGC
TAAATTTAACTGATATCTGACACGTCGAGTACTTCAACTTACTGGCTTCTAGGAGATAAT
TTCTTGAGAGGTTACTACTAAGTTTATGATATGCAGACACCTAGAATTGGACTTGCTGAC
TATAGATACATAACAAACGCCCAATTTAACTTCACAGGACAAGTTTACTTCGAACCTTCT
CCTAGCTCTGGAGATTTAAACCTTGGTGATAGAAATTTAATCATAATTATTGTCGTATGT
GTTGGAGGAATAATCGCTGTAATTCTGACAATAATGCTTGTCTATTGCTGTATTAAAAAC
AAAAAGGAAATGAGGAGGAGAAGATAGCAACAATAATAAGCAAATCAAGCTAATTAAATA
TAGCATCCCATGCCAGTAAATCCGCAACTTCAATAAATTCCTTATGTAAACTCTATGTAA
GGTCATCCGGTTGTCGTCGGACATCCTGTTGTATTACAAGGTCTGCCCACACATCATGAC
ATTAGAGAAATGCGTGATATTCAGCTAGCAATTGAACAATCATAATAAGCCTAAAATATG
CATAGAGTAGACAGCATGGAAGACGTTAGGTAGCAAATTGCTATCATTGAATAAAGTTCA
AGACATCAATAACTTGATGATTCAAGGATTAATATGAGGGATCCTTAGAACTATCCCTAA
CTTCATTGA


>Contig20708.0.g67(protein)
MLNQQRQAVTFSNVVLYALFIGISLNLVQSSNHTSKMNENLSEQVVPVQSKDYIEIDLHR
KEVLGPSRLMKFRNSNLEQSGFNGSRHLEDSIELNIMNYNNIQYYGYVYVGTPRQRFTFM
FDTGSSWVWLPSTNCSKDECSKGRYNTSTSSTYNQLGNTVTIQYAQGNVRGYVAQETVVL
DENGKFSVTDFNYLSVFSGGDVHTLESDGLIGLSVSKIGSQLQDLFVQKLFQQKKIGTYG
FTMFIGSTKQQSKLWIGTYLLPTTTQYGDLQWIKLSSNYHWQTSLTNVIINGQQIPLSKS
KDAILDSGTSLTYIPADEYNAIYNAITNGKNCWITQGYQFCSCKNSEDTSYPIIYFNLGG
VQFKMQPFQYLQTYSGLSGCQIQLISDTSSTSTYWLLGDNFLRGYYQVYDMQTPRIGLAD
YRYITNAQFNFTGQVYFEPSPSSGDLNLGDRNLIIIIVVCVGGIIAVILTIMLVYCCIKN
KKEMRRRRQQQQQANQANQIQHPMPVNPQLQQIPYVNSMQGHPVVVGHPVVLQGLPTHHD
IREMRDIQLAIEQSQQAQNMHRVDSMEDVRQQIAIIEQSSRHQQLDDSRINMRDPQNYPQ
LH