Identifiers and Description

Gene Model Identifier

Contig20680.0.g93

Standard Name

None

Aliases

Contig20680_0_g93

Description

Isocitrate lyase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00463 ) Isocitrate lyase family
  • ( pfam13714 ) Phosphoenolpyruvate phosphomutase
  • ( pfam13077 ) Protein of unknown function (DUF3909)
  • ( pfam10494 ) Serine-threonine protein kinase 19

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011415709.997093137033517e-262isocitrate lyase family protei
n
SGDYER065C7.001211497519606e-142ICL1 SGDID:S000000867, Chr V f
rom 286914-285241, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20680.0.g93(coding)
ATGACAAGCAATTAGAGATAGGAGACAGTAAAACCAACCGAAAGCTAGGTCCTAAACAGA
CTTAAGCAAGAGTTATCATTCCTCTGCTCTTATAAGAACATGGACATCAGTCACCCCTCA
GTAGAGAAGGAAATTGAACAGTACGTTGATAGAATAAGCAGTTTTACATATTAAGATGGA
GATCAAGTAGATACATGGTGGTCCAGCGAGAGATGGAGACATACAAAGAGAAACTATAAA
GCAGGAGATGTGGCATCACTCCGTTCTTCAATAGATTTGGTTACTCCCTCCCATTACTTA
TCAAGGAAATTGTACTAAAATTTGAGAGAGAAATTCATAGCAAGAGATTCCTCAAGAACC
TATGGTGCTCTCGATACTGTGCAGGTTATCAACATGTGTAAATACCTATCAAGTGTCTAC
GTTTCAGGATGGTAATGCTCTTCCACACATATTCCAGCTGGTCACGAGCCCGGTCCAGAC
TTTGCTGATTATCCAATGAGTACTGTCCCCGACAAAGTAATGCAACTTGTCAAATCTCAA
CTCTTCCACGATAGAAAGTAAAACGAAGATAGATTTAGCATGACCAATGAATAGAGATAA
CATCACAAGAAAGTGGATTATTTAGTTCCATGTATTGCAGATGCAGACGCAGGGTTCGGA
GGTATTACTTCAGTTATGAAACTAGTCAAGATGTTCATAGAAGCTGGTGCAGGTGGCATT
CATATCGAAGATCAAAAGCCTGGCGTTAAGAAATGCGGTCATCTTGGCGGTAAAGTGCTT
GTCTCAGCTAGAGAGCATGTGACAAGACTTTAAGCAGCCAGATTATAAGCAGATGTTATG
GGATGTGAATTAGTTCTATGCGCCAGAACAGATGCTCTTAGTGCCACTTTCTTGGACAGC
AATATTGACCCAGTCGATCATCCATTTATTTTAGGTTGTGTTGATCCCAAAAATCCTCAA
AAACTTTTGACTTTCCCCTAAGCTGGTAGAATTTCAATCTAATAAAACTTCCATAACGCA
GAAGAAAGAGAAAGATTATTGAAGATGTGGGACTAGCATGCTCTCCATCTATCTCTCCAA
GAAGCTTAAAAGTTAGCCTAGAAGCATAAATTTGATTTCTATTTCGATTGGGAAACATGT
AGAACTGAAGAAGGATATTACAGAATTGAAGGAAGTATCGCTTATTGTGTTCAGAGAGGT
CTCCTCTTTGCTGATTATGCAGATATGCTCTGGATGGAGACACCTACTCCAGAATTGCAA
GTAGCTAAGGAGTTTGCTGATAGCATTCATGCTCAAAAGCCACACGTTATGCTATCATAC
AATCTATCACCAAGTTTCAACTGGGATGCTCAGAAAATGACCGAGGAAGATCTAGAAAAC
TTCATACCAAATTTAGCTTCAATGGGCTATTGCTGGTAATTCATAACTCTTGCAGGTTTC
CATATGGATGCACTTATTAGTGAAGTGTTCACACGTAACTTTGCAGAGACAGGAATGCTT
GGATTCGTAGAGTACATTCAAAGAAAAGAAAAGAGTGAAAAAGTTGACTAATTATTGCAC
TAGAAGTGGTCAGGAGCTAACCTCAAGGACAGAGAAGTAGAGCTCGCATCAAATAATAAA
ATAAGCACACTATCCAACTAGAAGGGAGGTGGTACCACTGAAGATCAATTTTACAAGAAT
GGAGGACATGGTAAATAACATGGCCACCACTGA


>Contig20680.0.g93(protein)
MTSNQRQETVKPTESQVLNRLKQELSFLCSYKNMDISHPSVEKEIEQYVDRISSFTYQDG
DQVDTWWSSERWRHTKRNYKAGDVASLRSSIDLVTPSHYLSRKLYQNLREKFIARDSSRT
YGALDTVQVINMCKYLSSVYVSGWQCSSTHIPAGHEPGPDFADYPMSTVPDKVMQLVKSQ
LFHDRKQNEDRFSMTNEQRQHHKKVDYLVPCIADADAGFGGITSVMKLVKMFIEAGAGGI
HIEDQKPGVKKCGHLGGKVLVSAREHVTRLQAARLQADVMGCELVLCARTDALSATFLDS
NIDPVDHPFILGCVDPKNPQKLLTFPQAGRISIQQNFHNAEERERLLKMWDQHALHLSLQ
EAQKLAQKHKFDFYFDWETCRTEEGYYRIEGSIAYCVQRGLLFADYADMLWMETPTPELQ
VAKEFADSIHAQKPHVMLSYNLSPSFNWDAQKMTEEDLENFIPNLASMGYCWQFITLAGF
HMDALISEVFTRNFAETGMLGFVEYIQRKEKSEKVDQLLHQKWSGANLKDREVELASNNK
ISTLSNQKGGGTTEDQFYKNGGHGKQHGHH