Identifiers and Description

Gene Model Identifier

Contig20661.0.g89

Standard Name

None

Aliases

Contig20661_0_g89

Description

CRAL/TRIO domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002921404.001839059848271e-97CRAL/TRIO, N-terminus family p
rotein
SGDYMR079W9.997863464222902e-69SEC14 SGDID:S000004684, Chr XI
II from 424989-424997,425...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20661.0.g89(coding)
ATGTGGGGAAAGAAATCAAAATAACCAGAAGCAACAGGATTCATGGGAGACATGAACGAG
GATCAGGAGAGAGGCCTTGAAGAATTCAGAAGATACATTAAAGATAATAACGTTGTTGAT
CACCCTTAATATGATGATTACTACCTTCTTAGATTTTTGAGAGCAAGAAAATTCGATTAG
GACAAAACCAAGCTCATGTTTAACAACTTCGTCAAATGGAGAATTGATAATGATGTTGAT
AACATTATTGATAACTATGATTTCAGTGAGTCAAACGACCTACTTGAAGTGTATCCCCAC
GGTTATCACAAAATCGACAAGAAAGGAAGACCAATTTACATTGAGTGCCAGGGTAAATTA
AGGATTGACGAAGTTTTCAAGATTACCTCTGAAGAAAGATTAGTCAAGCATTACATCCAG
TCTTATGAGCAACTCCTCAAACTTAGATTCCCAGCTTGCTCTGCTGTTGCTGGTCACAGA
ATCGAATAAGGTCTCACAATCATTGATCTAACTGGAGGTTCTATGAAAATTCTAACTAAA
AAGGTCTACGCTCTGATTTAACTAGCATCCAAGATTGGTTCCGATTATTATCCAGAGATC
ATGGGTCAAATGTTTATCGTTAATGCTCCTATGCTTTTCACTGGTGTGTGGGCTGTTGTA
AAGGGCTTTATAGACGAGAAGACAAGAAAGAAGATTACAATTGCTGGAAGCAAATATTAA
AAGGATCTATTAGAATTAGTGGAAGATTATAACTTGCCAGACTTCCTCGGTGGAAAGTGC
ACATGTGCTGAGCATGGAGGCTGTATGAAGAGTAACCTTGGACCTTGGTAGGATTATGAA
ATTACCAAGCCAGTTGGTATCAGAAGAAAGCAAGGCAATGATCAAGAAGAGACAAAGAGC
AATCAACATTGA


>Contig20661.0.g89(protein)
MWGKKSKQPEATGFMGDMNEDQERGLEEFRRYIKDNNVVDHPQYDDYYLLRFLRARKFDQ
DKTKLMFNNFVKWRIDNDVDNIIDNYDFSESNDLLEVYPHGYHKIDKKGRPIYIECQGKL
RIDEVFKITSEERLVKHYIQSYEQLLKLRFPACSAVAGHRIEQGLTIIDLTGGSMKILTK
KVYALIQLASKIGSDYYPEIMGQMFIVNAPMLFTGVWAVVKGFIDEKTRKKITIAGSKYQ
KDLLELVEDYNLPDFLGGKCTCAEHGGCMKSNLGPWQDYEITKPVGIRRKQGNDQEETKS
NQH