Identifiers and Description

Gene Model Identifier

Contig20637.0.g110

Standard Name

None

Aliases

Contig20637_0_g110

Description

Cyclin

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • regulation of cyclin-dependent protein serine/threonine kinase activity (IEA) | GO:0000079

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007324602.999758165421992e-18Cyclin, N-terminal domain cont
aining protein
SGDYOL001W0.0000000000010000211161514907PHO80 SGDID:S000005361, Chr XV
from 325249-326130, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20637.0.g110(coding)
ATGGAAACAAATAGCCAAAGAGGGGCTTAAGAAAATCTGGGTCCATAAAACAATTTAAAC
AACACACTCACGAGTAGAGTGGGAAGAGTCCTAGCTGCTCTAACTCAAATGGGAGATTAA
ATTGCACTGCAATAACCAATGCGACAAGATAGTTCTGCATTTAGCAGCACATTACCATCG
AATATCCCTGTTCATGCCTATTTCATGTATGTTTCAATAAACTCAGGTTTAGCTGATAAT
CAAGCCATAATAAGTCTTGTACTCATTGAGAGGTTATGCAGAATTGCTAATCAAAACGGA
CTCCCTATCATTATTAACTCACTCAATATTCACAGATTAATACTAGCATCAGTCTTAGTG
GTGTCAAAGTTCTACAACGACTTATTTTTCTAGAATTCCTACGTGGCCTACGTTGGAGGA
GTGCATCCTTAAGAGATAAATTTATTGGAGAAGGAATTTATTCGTATCTTGGGCTGGTCT
CTATGGGTAGACCCCACGGAGTACGATTTCTATCTCAGAGGAATTATGCAACATTAGAAT
CTTACTGATTAAAACTAGTAACAGCAATATCAGCATACTCAACCTACAATCTAATGA


>Contig20637.0.g110(protein)
METNSQRGAQENLGPQNNLNNTLTSRVGRVLAALTQMGDQIALQQPMRQDSSAFSSTLPS
NIPVHAYFMYVSINSGLADNQAIISLVLIERLCRIANQNGLPIIINSLNIHRLILASVLV
VSKFYNDLFFQNSYVAYVGGVHPQEINLLEKEFIRILGWSLWVDPTEYDFYLRGIMQHQN
LTDQNQQQQYQHTQPTIQ