Identifiers and Description

Gene Model Identifier

Contig20600.0.g69

Standard Name

None

Aliases

Contig20600_0_g69

Description

Natural resistance-associated macrophage protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01566 ) Natural resistance-associated macrophage protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006917207.002403107011161e-144NRAMP family Mn2+/Fe2+ transpo
rters containin...
SGDYOL122C1.9992362000979228e-56SMF1 SGDID:S000005482, Chr XV
from 91419-89692, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20600.0.g69(coding)
ATGTCAGACTCCGCAGTGGGGATAGACTAAACCCTTGACAAGAGTGGAATTGAAGAGGAA
GACGAAAGCGAGGACAAAGATGGCGAAGCCCAGAGCCCTCTCTAATACCCTGAAACAGAA
CCTATTCCATTTCAGTTTAGTTGGAGGAAACTCTGGGCATTTTCTGGTCCCGGTCTTTTA
ATGTCTATCGCTTATCTTGATCCAGGCAACATTGCTGGTGATCTTGGAGCTGGAAATGTA
GCAGGTTACAGACTGCTATGGATCCTTTTGAGCTCTACTGCTCTTGGACTGTTCTTCTAA
ATATTAGCAGCAAGATTAGGAGTTGTAACTCAAAGAAATTTAGCAAGACTCTGCAGAGAG
CAATATCCCAAACATGTCAGAATCATTCTTTGGCTGATGACTGAGATAGCAATCATTGGT
TCAGATATTTAAGAAGTCATTGGTTCATCAATTGCTTTTAACATTCTATTTGGTTTACCA
ATATGGGCAGGTGCTATTATTACTATACTCGACTCCATCATTTTTCTATTTATCCATTAC
TTTGGCGTTAGAAAACTGGAAGGATTCTTTGCACTTTTGATTGGTACTATGGCAGTTTGC
TTTTTTGTCAACCTTTTTATTGTTAAACCTGATATTGGGCCTCTTCTTTTTGGTACTTTT
GTTCCCACAATTCCAGAAGGATCAGGCTCTCAAGCTATCGGTTTGATTGGTGCAGTCATT
ATGCCTCACAATTTGTATCTTCACTCTTCTTTAGTGCTTTCAAGAAAGGTCAACAACAAA
AATTAAAAGCAAGTCCATGAAGCTAACATTTACAATGCCGTTGAGAGTGGAATATCTCTC
TTCGTTTCTTTCATGATTAACTTTGCAGTTGTTGCTACATTTGCTTTTTATCACAATAAG
GGCTTTGATGACTTGAATTTGAGAAATGCTGATTAAGCTCTATACTCTTCTTTTGGAGAT
GCAGCTAGAATTATATGGGGTGTTGGACTTTTGGCAGCTGGGTAATCATCAACAATGACT
GGAACTTACTGTGGACAGTTTGTTATGGAAGGCTTCTTCGATATTAAACTACCAGTTTGG
AAGAGAGTGTTGGTAACAAGAAGCATCGCTATCATGCCTGCTTTAGCTGTCGCTTTCATG
CAAGATTTTGACGATGTTGACAATTACCTTAACATCTTGTAGAGTGTATAATTACCATTT
GCACTTGTTCCACTGCTAAAGTTTACCTCTTCTGACCTTATTATGGGAAGATTCAAGAAC
TCCAAGTGCGTTATGATATTCGCAATCCTTACAGCATTTTGTTTATTCGTTATTAATGCA
ATTGGTTTGGTACCAATTGGCGTTCCTGGCTGGGTATATGCTCCTTTCTCAATAGTTTTT
GCTTTGTATATAGGTCTCATCATTATTGTTCTCAGAGCTCCTCTTTCTCCTATAATGGAA
CACAAGGACTCGGAAATCGATGAAGGCTTTGACAAAGTCATTATCGCAGATTTCGATACT
TCAACTAAGGCAACTAATAAAAATTGA


>Contig20600.0.g69(protein)
MSDSAVGIDQTLDKSGIEEEDESEDKDGEAQSPLQYPETEPIPFQFSWRKLWAFSGPGLL
MSIAYLDPGNIAGDLGAGNVAGYRLLWILLSSTALGLFFQILAARLGVVTQRNLARLCRE
QYPKHVRIILWLMTEIAIIGSDIQEVIGSSIAFNILFGLPIWAGAIITILDSIIFLFIHY
FGVRKLEGFFALLIGTMAVCFFVNLFIVKPDIGPLLFGTFVPTIPEGSGSQAIGLIGAVI
MPHNLYLHSSLVLSRKVNNKNQKQVHEANIYNAVESGISLFVSFMINFAVVATFAFYHNK
GFDDLNLRNADQALYSSFGDAARIIWGVGLLAAGQSSTMTGTYCGQFVMEGFFDIKLPVW
KRVLVTRSIAIMPALAVAFMQDFDDVDNYLNILQSVQLPFALVPLLKFTSSDLIMGRFKN
SKCVMIFAILTAFCLFVINAIGLVPIGVPGWVYAPFSIVFALYIGLIIIVLRAPLSPIME
HKDSEIDEGFDKVIIADFDTSTKATNKN