Identifiers and Description

Gene Model Identifier

Contig20481.0.0.g5

Standard Name

None

Aliases

Contig20481_0_0_g5

Description

Glycosyl transferases group 1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL048W1.0002335610448659e-38ALG11 SGDID:S000004993, Chr XI
V from 538173-539819, Gen...
T. thermophilaTTHERM_001272305.999207186122604e-25glycosyl transferase, group 1
family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20481.0.0.g5(coding)
ATGCTTCTAAGAATATCATTATTATCTTTGGGAACCATTGCAATCCTTACCATAATATGC
ATAATCCTTATGAGACTAAAGACGTGGAATTAATTGAAGTATTTTAAGGGATACTTAAAA
GCCTAAAATTTCCCAATTATTGGGTTTTTCCATCCTTAATGCGATGGAGGTGCAGGTGGT
GAGAAAGTATTGTATTAAGCAATCCAAGCTATATAAGAAGACCCTGTATTTAAAAACTCA
AAAGTACTAATTTACTCAGGCTCAAAGAAGGAACCTTCAGAAATCTTGAAAGAAGTAAAA
TCACGATTCTCAATAGATATCAAGTATGAAAACTTGCATTTCGTGAATTTGGACACTTCA
GATAAATTGAAGCCAGAAAACTACAAATTCTTAACAATAGTATGGCAAGGTTTGGCTTCA
ATAGGAGTATGCTTTGAGGCTCTTTCTGTTGCTCCTTGCGATATTTTTATTGATACTATG
GGAGTTGGTTATGCATATCCATTTGTTAAGTTGTTCTTTGGACCTAAAGTTATTACATAT
ACTCACTATCCTATTATTAGATATCCACCTGTCGATACAACTGAGCTAAACAGAATACCT
TTAAATAATGTTAGATAAAACTACTTAGTTTCATTTGCTCAGTTCAGACCTGAAAAACAA
CATGACTTATAACTAAGAGTCTGGGCACAAGCACTTCCAAGACTCCCCTAAGATGCCAAA
TTTTACATGATAGGATCCGTACGTGATTAAGAAGATTAAAAGATAGTAGATAGACTGAAA
GACCTTGCTCAGCAATTACAAATATCTGATAGAATAAGTTTTGAGATTAACCAACCAAGA
GATAAAATATTATCAATTTTTGAATGTGCTAAGGCAGGTATTCATACCATGTAATACGAG
CACTTTGGAATTGCTATTTGTGAACTTATGGCTTCAGGAATCATTACAATTGCACATAAC
TCAGAGGCCAGTTGGTTACTTGGCTGA


>Contig20481.0.0.g5(protein)
MLLRISLLSLGTIAILTIICIILMRLKTWNQLKYFKGYLKAQNFPIIGFFHPQCDGGAGG
EKVLYQAIQAIQEDPVFKNSKVLIYSGSKKEPSEILKEVKSRFSIDIKYENLHFVNLDTS
DKLKPENYKFLTIVWQGLASIGVCFEALSVAPCDIFIDTMGVGYAYPFVKLFFGPKVITY
THYPIIRYPPVDTTELNRIPLNNVRQNYLVSFAQFRPEKQHDLQLRVWAQALPRLPQDAK
FYMIGSVRDQEDQKIVDRLKDLAQQLQISDRISFEINQPRDKILSIFECAKAGIHTMQYE
HFGIAICELMASGIITIAHNSEASWLLG