Identifiers and Description

Gene Model Identifier

Contig20452.0.1.g17

Standard Name

None

Aliases

Contig20452_0_1_g17

Description

Adaptin N terminal region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003160102.9998475177091926e-177Adaptin N terminal region fami
ly protein
SGDYPL195W4.998021988471165e-24APL5 SGDID:S000006116, Chr XVI
from 176223-179021, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20452.0.1.g17(coding)
ATGTCAAGCAGTGGTCATTTATCAAAAGAATTACTAGACTTAGTTAAGTCTATTGGAGAG
TCAAGATCCAAATAAGAGGAGGACAAGATTATTACAGCTGAGGCGCAAATATTAAAATAG
AAATTCTTAGAGAGAAATCTTGGAGAAAAGAAAATGAGAGAACTGCTCATCAGAGCTATC
TACGTGGAGATGTTAGGTCATGATGCTTCATTCTCACACATTCACGCAGTAAACCTCACT
CAAAGCAAGAATTTATTAGTGAAAAAGATCGGTTATCTGGCTTGCTCACTTTTTATTGAT
GAAAATTCAGAATTGCTAATTCTAATGATTTGCACAATCCAAAGAGATTTGCAATCTAAG
AATCATTTAGAAGTGTTGTCAGCACTCACTGTCCTCGGTAAGCTTTGCAATTAGCACATA
TTAATGGCTGTCAATGAAGCAGTCTAGAAACTGCTATCACATGCTCATGAAATGATCAGA
AAGAAGGCTGTTATGGTCATGATTAAGATGCATAAATCTTACCCATCTATCTTTGATCAG
ATGGATCTAAAAATGAAGAAATGTCTCTGTGATAAAGATCCCTCTGTAATGGCAGCAACT
CTGAACTATTTCTGTGATTAAGTTAAACAGAGACCAGCAGATTTCAAAGACCTAGTCAAT
TCATTCGTTGTCATTCTGAAACAAGTTGTTGAACACAGATTACCAAGAGACTATGATTAT
CATAGACTCCCAGCTCCCTGGATTCAAATAAGAATCCTTGAGATTCTTTCATACCTTGGT
GCAGATGATAAACATACTAGTGAGTAAATGTATGAAATCATCAATTAAGTACTAAAGAGA
GCAGACGATAGTGGAATCAATATCGGATATGCTCTTGTCTATCAGTGTTTGAAGACAATT
ACTAACATCTATCCTTCTCAATCTTTGATTGATTCGGCAACCACAACTATTTCACGTTTC
CTCAGCTCAGAGTCTCACAACTTGAAATATATCGGTATCACTGGCCTTGCTTATATCGTG
AAAATTGATCCCGTATACACTCTAAACTACTAAAGTTTAGTAGTAGATTGCCTTGAAGAT
GCCGATGACACTCTAAAGATAAAAACTCTAGACTTACTGTTTAAAATGACAAACAAATAA
AACATTGAAGCTATTGCTGAAAAACTGTTGAGCTATTTGAAGGAAGCTCCTATTGAATCT
AGTGTCAGGAAGGATTTAGTCATTAAGATTAACAGTTTATGTGAGGATTATGCGCCATCC
AAGAATTGGTATGTCAGAACTATGAATAAACTATATGAAATGGGTGGTGATCTCATAACA
AGCGATCTTTCAAATAAGTTTATTTCATCTATCAGTGAGTATGAGAAGGAAAGTGAGGGA
GAAAAGTTCAGAGATTCTACAATCACAATTTACCTGAAAATCTTAAAGAAAAACACTATA
ATTCCAGACTCCATGCTTTAAGTCATTGCATGGATCATGGGTGAGTATGGTTCCACTCTT
CCAAACCAAAAGAAAATCACGAAAATATTGAACTACTTGAGTGATGCAGCCTATAGACCA
TTGGAAGATGAACTAACCAGAGGATATATACTCACTGCAATTACTAAACTTCAGATGATT
ATGAATTTTGAAGAAAATCCCAAAGTTGAAATGGTGATGGAGGATTACATCTAGAGCAAA
CACGTTGATGTCCAATAACGTGCAATTGAATACAAGCAACTTCGTGAGAATCACCAACGT
ATCAGCAGCACAATCATGACTAAAATTCCCTTGAATGAAAACCAAATCCTCACCCAGGCT
TTCGACTTTGAGCTTTCTTTCTTGAATGATTTCGTGCAGACTTAACTCTCAAGCGGCAAA
AAAGAGTATGACTAGAGAAAGAGATAAGCTGGAGACTTGAATGGCTTGGATCTCGTTCTT
TCTCAACAGAACAAAGGTGAGAAGGGATTAAACTATAAGCCTTATGAGACACCAGGTATG
TCTAGAATCAACACTGAACTACCTTAGAGTAACCCCTTATTCCAGTAGTAACCGCAGGTA
AACCCAAATGACTCGATTTAATTGCAAAATGTGCAGAAAAAGGTATGGGGACAACCCTAA
CCAACACCAACTCCCATCGCAACTACAGGTGGTGCTAACAATACCCCTCATTATGAATCT
GCTAATAATTTAAAACTAGCCACCAATCAAATGGAAAGCCTTGGAACTAATCCTGAATTA
CAGCCAAAACCTAAAGTTAGCGAGAAGTAACAACATAAAGCAGATGAAAAAATCAAGAAA
GCTTCTGGGTTATTTGCTGGTATTGGAGATGCAAATGGCAAGAAAAGAGATGACAGTGAA
GATAGCAGTGATGAAGATAAGAAGAAAAGAAGAAAGGATAAAAAGAAGAAGAAGCAGGAA
GATCAAGAAGAAACCAAAGCAGGTAGTGATGTCTCAGCTATTATGGGTGGTAATTTGCTT
GAATTCGACATGCCAGCCTCCACAACTTCAATTAACGATGGTTTAGGCAGTTTGCTCGAT
CCAACCCCAACTATAAGCAATACTCCTTAGTAACCAGTGGCCAATCTTTTGGAAGATCTC
TTCTCTACAGGAGTATCATCAAACGTACCTCCAAGCATTGCCAATCACAGATTTAGCTCA
CTGCCTATTAACACTCAGCAATTCGGTGAACTCTGGGTCTAAAACCCAGTCGAAAAGAAA
ATTGTCTTGCAAATGCCATAAATATCCAGCCCTCAGGTTTACTCTAATCAAATCAGAAAG
TTAGACTTCAATGTTGTAGAGATCATAGGTAATGAAGTAATTAGTGCTGGATAATCACAG
ATAAATGGCTCTGTCAATCTCATTCATTGTAGAGTAAATATTGGAGGCCACTTGGAACTT
ACTATTAAGGGATCTGATGTAAATACTGTCGATTCATTAGTAAATACACTCATCCCTCAA
GTCCTTGCAAGCAGTCTATTCTGA


>Contig20452.0.1.g17(protein)
MSSSGHLSKELLDLVKSIGESRSKQEEDKIITAEAQILKQKFLERNLGEKKMRELLIRAI
YVEMLGHDASFSHIHAVNLTQSKNLLVKKIGYLACSLFIDENSELLILMICTIQRDLQSK
NHLEVLSALTVLGKLCNQHILMAVNEAVQKLLSHAHEMIRKKAVMVMIKMHKSYPSIFDQ
MDLKMKKCLCDKDPSVMAATLNYFCDQVKQRPADFKDLVNSFVVILKQVVEHRLPRDYDY
HRLPAPWIQIRILEILSYLGADDKHTSEQMYEIINQVLKRADDSGINIGYALVYQCLKTI
TNIYPSQSLIDSATTTISRFLSSESHNLKYIGITGLAYIVKIDPVYTLNYQSLVVDCLED
ADDTLKIKTLDLLFKMTNKQNIEAIAEKLLSYLKEAPIESSVRKDLVIKINSLCEDYAPS
KNWYVRTMNKLYEMGGDLITSDLSNKFISSISEYEKESEGEKFRDSTITIYLKILKKNTI
IPDSMLQVIAWIMGEYGSTLPNQKKITKILNYLSDAAYRPLEDELTRGYILTAITKLQMI
MNFEENPKVEMVMEDYIQSKHVDVQQRAIEYKQLRENHQRISSTIMTKIPLNENQILTQA
FDFELSFLNDFVQTQLSSGKKEYDQRKRQAGDLNGLDLVLSQQNKGEKGLNYKPYETPGM
SRINTELPQSNPLFQQQPQVNPNDSIQLQNVQKKVWGQPQPTPTPIATTGGANNTPHYES
ANNLKLATNQMESLGTNPELQPKPKVSEKQQHKADEKIKKASGLFAGIGDANGKKRDDSE
DSSDEDKKKRRKDKKKKKQEDQEETKAGSDVSAIMGGNLLEFDMPASTTSINDGLGSLLD
PTPTISNTPQQPVANLLEDLFSTGVSSNVPPSIANHRFSSLPINTQQFGELWVQNPVEKK
IVLQMPQISSPQVYSNQIRKLDFNVVEIIGNEVISAGQSQINGSVNLIHCRVNIGGHLEL
TIKGSDVNTVDSLVNTLIPQVLASSLF