Identifiers and Description

Gene Model Identifier

Contig2043.0.g70

Standard Name

None

Aliases

Contig2043_0_g70

Description

SAC3/GANP/Nin1/mts3/eIF-3 p25 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam03399 ) SAC3/GANP/Nin1/mts3/eIF-3 p25 family
  • ( pfam10075 ) COP9 signalosome, subunit CSN8

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006491104.9998290395614495e-4026S proteasome non-ATPase regu
latory subunit ...
SGDYFR052W0.000000000040005666873964816RPN12 SGDID:S000001948, Chr VI
from 252505-253329, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2043.0.g70(coding)
ATGGTTAGTCATATCGATCGCGTAGTTAATGGACTCTAAAAACTGAAGTCAATTAGTGAG
GACTCTTCAACTCTTGGGGAAAGAGAGAAAATCGTGAGGCAACTCAAAATTGACTTGACT
TTCTTCCAAAACATACCACCATGCTTTCAGCCAGATGCTAGAGAATGCATCTTAGCAAGA
GAGGTCTATGAGTATGCTACATTCTTGAGCGTTGAAAAGTAGAATATTCAAGAGTATGAG
AATCACATGAACATCTTGAAAACCTACTACGATGAATTCTCTGGCCTGATTCCTCCTTCT
CAAAAGATGTACGCTATCCTTGGACTTTACCTCCTCTACTTGCTCTCTTACAATAAAATC
TCTGAATATCACACTGAAATCGAGCTGATCCCAATCGAAGAGCTTTCAAACGTCTACATT
AGCGTCCCCGTATCCTTGGAGCAGCACTTTGTGGAGGGCAGCTACAACAAAATCCTTAAC
CAACAACAGAAAGTGCCCCTAGAAGCCTATCACTTCTTTATCAACAAATTCGTTGATGCC
ATTAGATTTGAGATAGCCAGATCAAGTGAGAGAGCCTATGAAAGTCTAAGCTTGAGAGAT
ACCCAGCGCATCTTTATGATCCAAAATGAGCAGGAATTGTTAAGTTTCATCAACAACAAC
AGCGGCAAAGAAGGCGTGCAGTGGGTTATTCAAGGTGACAGATTACACTTCCACAGATAG
AAGGAGCAACTAAAGGAGATTCCATCAAACAAGATGATTTCATTGTGCCTTGACTACGCC
ACAGAACTTAACAGAATCGTATGA


>Contig2043.0.g70(protein)
MVSHIDRVVNGLQKLKSISEDSSTLGEREKIVRQLKIDLTFFQNIPPCFQPDARECILAR
EVYEYATFLSVEKQNIQEYENHMNILKTYYDEFSGLIPPSQKMYAILGLYLLYLLSYNKI
SEYHTEIELIPIEELSNVYISVPVSLEQHFVEGSYNKILNQQQKVPLEAYHFFINKFVDA
IRFEIARSSERAYESLSLRDTQRIFMIQNEQELLSFINNNSGKEGVQWVIQGDRLHFHRQ
KEQLKEIPSNKMISLCLDYATELNRIV