Identifiers and Description

Gene Model Identifier

Contig20358.0.g82

Standard Name

None

Aliases

Contig20358_0_g82

Description

RIO1 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000466802.999977985165137e-107RIO1 family protein
SGDYOR119C1.9993206333383003e-80RIO1 SGDID:S000005645, Chr XV
from 550246-548792, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20358.0.g82(coding)
ATGACAAGCAGGAGAACTAATAGGAGTGCAGCATCAGCAGCAGTTGTGGATGATGATAAC
TTTGACCCCACAGAATTTAAACAGCAGAATGACTTTAAAGTGCAAGATATGAAGAAAGAA
ACCATAATTGATAAGCAATCAGAGACAAAGACAAAGAAGATTTAATTTTAGAGAAGAGAA
GCAGGAGACTCTGATCCTGAATCAGTTGAGTATGACAGTGAAGATGAATATGGTGGTGAA
GACCAGGATGATGATGACTATTATTAAGAACTGCAGCAGTACTATGGCAATAATAACCCA
AATAGCCAGTCCAATTAACAAGCCAATGTAAATCCTTAATAAAATGTGCAAACATCTTAA
GTTTAGCTATAGAAAAGTGCAATTCCTGTTAGTGAAAAGCAAAAGACTTCAAATAATCAA
GAATCTACAAACTAACTATCAAGCAGCAATTAATAGGATGAAGAACACGAACAGAAAAAA
GAAGATAAAATGCTGAAGGCTTTTTATCAATAAAAAATGAACAATAATGCATCTGATAAG
CAATAATTACTTATTTAAAACAATAAAAAAATTAATCTCAACTATGTTGATCACAAATTA
GAGATGCAACTTGGAGTTAAAGTTAATAACTCACTCAAAATCTAGCAATAAAAGATTGAT
GATGATCGCATTAGAGTGAAAGACAAGAATGACAGAGCTACAGTGGACTAAGTATTAGAT
CCAAGAACACTCATAGTGCTACATAAAATGATTAAAAATCAAAAGTTAGATATAGTTTAT
GGGTGTTTGAGCACGGGAAAAGAAGCAAATGTATATCTAGCAGAAGGTCATATGGACTTA
GACACTATGGAATTAAAAAATCCAGAAGAGTTCAAGAGAGAATTCGCCATTAAGATATTC
AAAACATCAATATTGATTTTCAAAGATAGAGAACGCTACGTGGAAGGTGAATTTCGTTTT
CGTAAGGGGCACTGCAAATCAAATCCCCGTAAGATGGTTTAATTATGGGCTGAAAAAGAA
GTAAGAAATCTTAAGAGATTGAATTAAACCGATGGAGCCATTAAAGCTCCTAAACCCTAC
CTCCTCAAGAACAATGTTATAGTTATGGAGTTCATTGGTGAAAATGGTCTAGGAGCACCT
AGATTGAAAGATGCTCAAATTATCGATTTGCAATAGACTTATGCAGATGTTTTATTCATA
ATGAGGAGGATGTATCAGATGTGCAGACTAGTTCATGCAGATTTCAGTGAATACAACATG
CTCTACTATAAAGGAGAAGTGTGGGTAATTGATGTTAGTTAATCAGTTGAACATGATCAT
CCCATGGCTTTGGATTTCTTAAGAAGAGATTGTGCTAACGTTAATGACTTTTTCAAGAAG
AGAGGACTCCATACTCTCAACACTTAACAGACATTTGACTTTGTAACAGACATTACAATG
ACAGATGAATCTCAAGGGCTAACAGATATATTCTCTAAACTCAAAGATGTAATTTCAATT
GAAGATGAAGTCAATGATAAAGTATTTGAGCAGTCATATATACCACGTACCCTTCAAGAG
TTGACTCTCGAAGAAATTGAAAAGGCGAAGAATGGAAATAGACTCTATGCCAAACTAACT
GGAATATAAGATTAATAAGAGAAGTAAGAAGAAGGGGTAATTAAGGAACAACCAAATCAG
GAAGATGTCAAGGATGACGAGGATAAGAAGGAAGATAGTGATAATAGTGACAGTGAAGAT
GATGAAGAAGATAAAGTAGATCCTACCGTAAGTTTAAAGGGTATGACCAAGGAATAAATG
AAAGAGCATAAGAAAAAAGTCAAAGAAGAGAAGAGGGAGAAAAGAAAGACAAAAGTACCA
AAGTATGTCAAGAAGAAGGGTGAGAAGAAAAACAAAAAGTGA


>Contig20358.0.g82(protein)
MTSRRTNRSAASAAVVDDDNFDPTEFKQQNDFKVQDMKKETIIDKQSETKTKKIQFQRRE
AGDSDPESVEYDSEDEYGGEDQDDDDYYQELQQYYGNNNPNSQSNQQANVNPQQNVQTSQ
VQLQKSAIPVSEKQKTSNNQESTNQLSSSNQQDEEHEQKKEDKMLKAFYQQKMNNNASDK
QQLLIQNNKKINLNYVDHKLEMQLGVKVNNSLKIQQQKIDDDRIRVKDKNDRATVDQVLD
PRTLIVLHKMIKNQKLDIVYGCLSTGKEANVYLAEGHMDLDTMELKNPEEFKREFAIKIF
KTSILIFKDRERYVEGEFRFRKGHCKSNPRKMVQLWAEKEVRNLKRLNQTDGAIKAPKPY
LLKNNVIVMEFIGENGLGAPRLKDAQIIDLQQTYADVLFIMRRMYQMCRLVHADFSEYNM
LYYKGEVWVIDVSQSVEHDHPMALDFLRRDCANVNDFFKKRGLHTLNTQQTFDFVTDITM
TDESQGLTDIFSKLKDVISIEDEVNDKVFEQSYIPRTLQELTLEEIEKAKNGNRLYAKLT
GIQDQQEKQEEGVIKEQPNQEDVKDDEDKKEDSDNSDSEDDEEDKVDPTVSLKGMTKEQM
KEHKKKVKEEKREKRKTKVPKYVKKKGEKKNKK