Identifiers and Description

Gene Model Identifier

Contig20294.0.g9

Standard Name

None

Aliases

Contig20294_0_g9

Description

Thymidylate synthase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003121206.000727524697947e-169bifunctional dihydrofolate red
uctase-thymidyl...
SGDYOR074C3.000551941601253e-121CDC21 SGDID:S000005600, Chr XV
from 467589-466675, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20294.0.g9(coding)
ATGTTATCGCACTAATAAATAAAGTATAAACCCTTTTCAGTCATTGTTGCTTGTTCAAAG
AATGATGGCATTGGATTCAAAGGTGACCTTCCATGGCCTAAAATACCAAAAGAAATGAAG
CATTTTGTCAATGTTACTACTTCCAAGGATCCATTAGCTTTTTCACCAGCAGAGAATGCT
TTCAAAAATGTTTTCTACTAATCAGGATTCACAGCAAAGAATCCTTCAAATGGATTAGAC
AAAGTGAATGCAGTGATCATGGGTAGAAAGACTTGGGACTCTATTCCTTTGAAGTTCAGA
CCACTTACTAAAAGAATGAATGTTATTCTCACTAACCAACAAAACTTGGAAGACACTAAT
GATGAGAATGGTCTCATTCAAGTGTACAATGACTTCGAAAGAGCTCTTGAAAGTCTTTCA
AATGATCCCAGAGTCAATGAAATCTTCGTTATCGGAGGAGCTACTGTTTATGATCTGGCT
ATAAATAAGTTCTCCGACTTTTGTAAATTAATCATAAAAACAAGAATCAACAAGGAGTTT
GAAGTTGATACTTTTATGCCAAAAATGGATGAAGAGGGAGCCTATTCTAAGCTGTACATC
TCTCAAACATACTCTCATCAAGATGTCACTTTTGATTACTGCTTCCTTGGAAACAAGAAA
CTTCTTTCATACAAACCTGAGTTAATCCCAACTCGTCTCTTCAGCAAGTACCCCAAGCAT
CCAGAGATGTAATATCTTGAAATTATTAAAGATATTATTGAGACGGGCAGTGAAAAGTCT
GACAGGACAGGTGTTGGTATCATTGGAAAGTTTGGATATCAAATGAGATATGATCTTGAA
GAAAGTTTCCCAATTCTCACTACCAAGGATGTTTTCTGGAGAGGAGTAGCTGAGGAACTT
GTTTGGTTTGTTAAGGGCGATACAAATGCCAAGAACTTAGCCGACAAAAAGATCAGAATT
TGGGACGGTAATGCCTCAAGATAGTTCCTTGACTCTATCGGCTTGAAAGATAGAGAAGAG
TGGGATCTCGGGCCAGTCTATGGGTTCTAATGGAGACACTTTGGAGCTGCTTATGAAACA
ATGCACGACGATTACACAGGAAAAGGATTTGACTAATTGGCTGACGTCATTAATCAGTTG
AAGAACAATCCAACAAGCAGAAGAATTGTGATGAGTGCTTGGAACGCTGCTGATCTTAAA
AACATGGCTCTTCCTCCCTGCCACATTTTAGCTTAATTTTATGTTTCTGCTGATGGAAAG
CTTTCCTGCCAAATGTATCAAAGATCTTGTGATATGGGTCTTGGTATTCCTTTCAACATT
GCGAGTTATTCATTGTTAACCTGCATGCTTGCACAAGTGTGCGGATTGAAGAGAGGAGAG
TTCATTCATGTATTAGGTGATGCTCATGTATATAAAAATCATGTTGAACCACTTCAAGAG
TAACTTAAGAGATACCCATATCCTTTCCCACAACTCGTTCTTAACCCTGACATTACTAAT
ATTGAAGATTTCTAATTCTCAGACTTTAAACTTATTAACTATACTCACCATCCAAGAATT
AAAATGGAAATGGCTGTTTGA


>Contig20294.0.g9(protein)
MLSHQQIKYKPFSVIVACSKNDGIGFKGDLPWPKIPKEMKHFVNVTTSKDPLAFSPAENA
FKNVFYQSGFTAKNPSNGLDKVNAVIMGRKTWDSIPLKFRPLTKRMNVILTNQQNLEDTN
DENGLIQVYNDFERALESLSNDPRVNEIFVIGGATVYDLAINKFSDFCKLIIKTRINKEF
EVDTFMPKMDEEGAYSKLYISQTYSHQDVTFDYCFLGNKKLLSYKPELIPTRLFSKYPKH
PEMQYLEIIKDIIETGSEKSDRTGVGIIGKFGYQMRYDLEESFPILTTKDVFWRGVAEEL
VWFVKGDTNAKNLADKKIRIWDGNASRQFLDSIGLKDREEWDLGPVYGFQWRHFGAAYET
MHDDYTGKGFDQLADVINQLKNNPTSRRIVMSAWNAADLKNMALPPCHILAQFYVSADGK
LSCQMYQRSCDMGLGIPFNIASYSLLTCMLAQVCGLKRGEFIHVLGDAHVYKNHVEPLQE
QLKRYPYPFPQLVLNPDITNIEDFQFSDFKLINYTHHPRIKMEMAV