Identifiers and Description

Gene Model Identifier

Contig20249.0.g40

Standard Name

IMA1a

Aliases

Contig20249_0_g40

Description

Armadillo/beta-catenin-like repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL189W9.997217559668329e-127SRP1 SGDID:S000005133, Chr XIV
from 284260-285888, Geno...
T. thermophilaTTHERM_010162204.99764318480009e-123Armadillo/beta-catenin-like re
peat family pro...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20249.0.g40(coding)
ATGGAAGGTACAAACAATCAACAACCAAATCAGCAGACCAACTTCGGTGCAGGAGCTCAG
GGCTCAAACGTTCAAGTTGACTTCGCTATTGGAAAGACCGACAAGGACACAGGCAAAGCC
AAGGTCAAGAATTTGGAAGAAATCGCAGAAGAGAGAATGAGATAAACTTTCAATGTGGGA
GGTGGAGCAAAGGAAAATGATGATTTAAAGAGAAAGAGAGAAGATTATGCGGTACAACTA
AGAAAGTCAAAGAGAGAGGAGGCTTTCAAAGCTAAAAGAGCATTCATCGGAGAGGGAGCA
ATGGGATCAAGTGCTCAGACAACAGGATCATCAGATAGCACTCAGCCTTTGAACTTAGGA
CCTCAAGGACAATTCCCAGACTCAGCATTGTTGCAGATAAGTATTGAAGATGCTTTGCAA
TCAGCAGAAAATATGAGTCCAGAGGAATTCATTGTTCAAGCTTAAAGCATGCAATTCAAT
GTTCAAGATTTCCCAAAACTATTGATGCTCATCCAAGACACCAACGTGCTCAAGCAACTC
TTTGCTACTATTGGATTTAGAAGATTGCTGTCAAGAGAGCAAGGTCCCCCCATTCAACCA
GTCATTGACGCTAATCTTGTGCCAAGATTCATTTCATTCTTACAGAGAACTGATACTCCC
AAGCTTCAATTCGAAGCAGCCTGGTGCTTGACTAACATCGCCAGTGGCCAATCAGAATAA
GTTCAAGTCTTGATCGACAAGGGAACTATCGTAGTCCTAGTTGACTTATTGGGCTCAGCT
CATTTGGAAGTCGTTGAACAAGCAATCTGGGGACTTGGAAATATTGCAGGTGACAGCTAT
AAAGTGAGAGATCTTGTCATTAATGCAGGTGCTGTAAACCCAATCGCAGCTGTACTTGAT
CAAGCCAAGCCAGGATCTTCACTAGCCAGAAATGCAAGTTGGACTCTTTCAAACTTGTGT
AGAGGTAGGCCTGCACCTCATTTCGAGAAAGTCAAGAGAGCCGTTCCATCACTTGCTAAA
GTCCTCATCGAAAATGATCTTGACGATATTCTTGTTGACGTCTGTTGGGCCATCTCTTAC
CTTTCTGACGGAGGAGAAGAAAGAATCCCAGTCATCATGAGCACTGGTGTACTTCCAAGA
CTAATTCAACTCTTGCAACATAACAACATCGCTATCTCAGTGCCATGCCTCAGAACTATT
GGAAACATTGTAACTGGAGATGATGACTAGACATAATTTGTGATAAACGCAGGTGCTTTA
GACGCTTTGAACAACATTATTTACCACAGAAAGAAGACTGTAAGAAAGGAAGTGTGCTGG
TCACTTTCTAACATCACTGCTGGAAACCCCACTCAAATTCAAGCATGCCTTGACTTGGGC
ATCATGGATAAGTTGATCAACTTGCTTTAAAATGATGAATTAGAGATCAAGAAAGAAGCT
GTTTGGGCTGTTAGCAACTGCACAGCTGCTGCTACTTTCGAGCAATTCGTTTCTTTGGTG
CAGAAGGGTATTCTCAAATCATTAGGCTCAGTGCTTAAAATGAAGGAAGCAAGAATACTA
GCTGTTGCTCTTGAAGGTATCGAGAACATCTTGAAGTCTGGACAAGAACACTTCCCTAAG
CATGGTCAAGAGAATAAGTTCACAATCGAGTTAGAGATGTGCGGTGGTCTTGAAGAAATC
GAACAGTTGCAAATGCATCCAAACCACCAAATCTATGAGAGAGCTTTGAAGATCCTTGAA
ACCTACTATCAAGATCAGCAAGAGGAAATGTACGATGTTGGTAACACCGCCTCTACTCAG
CCAAGCACTGGCAATGTATTTAACTTCTGA


>Contig20249.0.g40(protein)
MEGTNNQQPNQQTNFGAGAQGSNVQVDFAIGKTDKDTGKAKVKNLEEIAEERMRQTFNVG
GGAKENDDLKRKREDYAVQLRKSKREEAFKAKRAFIGEGAMGSSAQTTGSSDSTQPLNLG
PQGQFPDSALLQISIEDALQSAENMSPEEFIVQAQSMQFNVQDFPKLLMLIQDTNVLKQL
FATIGFRRLLSREQGPPIQPVIDANLVPRFISFLQRTDTPKLQFEAAWCLTNIASGQSEQ
VQVLIDKGTIVVLVDLLGSAHLEVVEQAIWGLGNIAGDSYKVRDLVINAGAVNPIAAVLD
QAKPGSSLARNASWTLSNLCRGRPAPHFEKVKRAVPSLAKVLIENDLDDILVDVCWAISY
LSDGGEERIPVIMSTGVLPRLIQLLQHNNIAISVPCLRTIGNIVTGDDDQTQFVINAGAL
DALNNIIYHRKKTVRKEVCWSLSNITAGNPTQIQACLDLGIMDKLINLLQNDELEIKKEA
VWAVSNCTAAATFEQFVSLVQKGILKSLGSVLKMKEARILAVALEGIENILKSGQEHFPK
HGQENKFTIELEMCGGLEEIEQLQMHPNHQIYERALKILETYYQDQQEEMYDVGNTASTQ
PSTGNVFNF