Identifiers and Description

Gene Model Identifier

Contig20227.0.g47

Standard Name

None

Aliases

Contig20227_0_g47

Description

SET domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002394009.999453238338778e-112SET domain containing protein
SGDYHR119W0.000000030002053728821195SET1 SGDID:S000001161, Chr VII
I from 346043-349285, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20227.0.g47(coding)
ATGATAACCTCTTAAGATTAAGCCTCAAATATGAGTGCTTTACAATGCAACCCATCTACT
TATCCCTAATGCTATATCTGTTCATAATAGCTATAGCGGGATCCCTCTCAGGGTGTTTAG
ATGTGTTAGACATGCAAGACTCAGGCTCATTTAAGCTGCCTTTAAAACTCCCAAAAAATC
AAGAGTAATGGAGAATGGCGATGTGACATCTGCATTTAGCAGAATCAAAAAATGATGACT
GAATGCTTCATTTGTTGTTAGCCAACCTCCGAATAGATTTAATTGGCAATATTTAATGAG
CCTCATGAAATAAGCACCGGTAATTTATAACAACTAGAAGGTTTACATTCATCAGTCCAA
AATATTCTGACATTTGGGCATGAGAAATGCCTAATTGAAAAACTCCCATTCACCAATCAG
AATTTAGAGAGACGTCAACCCTATTAAATTTCAAGAAAAGATTATATAAATTTAAAAAGT
GCAGGTAGAAGCCAAAGCTAGAGCCCAGACAGAAATTCGAACAAGAAATCAGAAAATGGA
AGTCTTACTAGCGATTAAAACACTATAATTTAGGCCTAAAGCACATTTTAGCCATAATTA
ACTAACTAAATACCTTCTTAAAATCAGTATAAGCCCGCCAATCTACAAAGCTTGCTGGCG
AGACATCCAAAAAATTTCTAAAGTTTCAACCATCCAACTCAATCTCAAAATAAGAATATC
CTTTCTGCTTCCTCTGAGGCATAGATTACAATTAATGGTTCATAAACTGATAATAGCTAA
TTTTAATAGAAACAATCAAATTTATATAATTAAGTTCGTAGTGATAACTTCGAGCAGGTT
TAATTAAAACATAATCAAAGTGTTATTGCAGTTGAATAAAATTAAAACTTTTCTAATGTC
TCAATTTAGTCAGAATTGGTTTCACAGACGGACAACTAAAGTGAAACTCTTACCGATTAC
TTCCAAAGAAGAGACTTTTAAGCTATAAATTAATCAGCATCTTTGCAACAGCATCACAGT
GCAAACTTTTAGAGTACTAACCAAGGACCATTAAATCAAACTGCACCACCAAAGCTCAAT
CAGAATGGCGTCAAAATCAAGCTAGATTTGCACACTGAGAAGATGATCGGCAAGCGTTAG
AGAAGTGCTGGAGATAATGAAATGGTCAAAAATACTATTTCAAAAGAGCAGAAAGAAGAA
CTAAAACATGACTTGGATTTGATTAAACAGGAAAATTAATCAGTAGAGGATTTGAATGAG
GGAAATTAAAATTAAAGCAAAGAAAGAAGATCTAAGAATTTGGAAAACTCTCCTGGATAG
AGTAGCGAAATGACTAAGAATAAGATGCTTAAAGCACTAGATGCTGATCCATCATAGTTC
GTTGTGAAGGAAATATTGACTCCAATTCTTTTTTAAATTGACAGGCTATAATTTATGAGA
AGAGACAAGCAAAAATTTGAGATAAATTTGCTTAATAAAGACCTTAAATTACTCTCTAAA
GAAAGAAGAGAAGAGATACTAAACACTACAAGTTATTTAGATATCATTGAGAAGCCAGGA
TAATAGAAAGAAGTTGATTTAGTGTTCATTATTGATTAAAATTTACCTTAAAGACTAATA
GATTCTACAAGAACAAGCAGTAACAATCAAAATGATTAGCAACTAAATACAGTCCCATTA
GAAAATACAGACATAAATATTCAACCGAATCTTGATGAAAGATAAGAGTCAGATTTACTT
TCAGCTTAAGATAAGAATTCAGAATTATCTCCAGAAAATGAAAAAATGGAAGTTGATAAT
GACGAGGAGAGTTAAGAAATGAAAATAAGGGATTCAAAGATTTTTGAGGAAGAAGGTTTT
AACATAACTGGAGGTTCTGACGAGCAATCAAAAGCTAGCTCTGATTGCTTGAGTAAAAAA
AAGAAAAAAAAGAAGTCATATGGTCACAGTGCAAAATCAAAGAATCTCTCTAAGGCATTG
CTTAATTTACCCTCTAACTTGAGTGACTTTACTTGGATTGAAAACACTCAGCTTAATAAG
TAACTTCTGGAAGAGGAAAGGGAGAAACAAATCCAACTAAAGAAGCAAAAAGAACTAGAG
AGAAAAAGTAAGCAACAAGATTCAGAATCAGATCTATCAGCCGATTTTAGTATTAAAGTC
AAGCAAGTAACTTGTGAAGAGGATGGTCTATAATTATCTGAAACTAAATTGGAAAATTAA
GCAAAATAAGATGTTGAAATGATTGATACATCAACGAAAATAGTTGAGCCACCTCAAATA
CAAAAATAAGTTGAGCAAAAACCTTATGATTTCAAATCTAAGCAAGGTATCTAGTCAATT
GATGATATCTGGGAGAGAACAGATGATGGCTATTACCATTCTTTGGATGAATTATTGAAG
GACATTGAAATACTTGTTTATTTAAGCTTCATGCTGCAAAGAGTTAATGTACTTATTAAA
ACTAAGAAAGAAGAATTTAAATTCAGATGGAGAAACTACTATGAAGCTAAGTATGTTTAA
AATGATCTGTACTATCCAAGAATCAAAGGATCCTGGTGGAAGACACCTGGGGCTAAGAGG
GAATACAATTTGATTGATAACTACAAAATAATGACACCAGCCGAACCAAGCAATAAGTAT
CTTCAAGGTAGTCAAGTGTACAAGCAGGAGATCATCAGAAAGATGTAAACAACAAAGGCT
TCTAAGTGTCAGGGAGCTTGCTGTCTAAAGATAGAAGACCTCGGACCCTTCAAATTAGGT
TCAGATGTTTGGGAATCAAAATGTGAATGCAGACTTGCAAGAGTTGAATGCTCAAAAGAT
TGCGGTTGTGATCCAACTGTATGTCAGAATAGACAAATGTCTCAAAACCAAGGATTAAAA
TTGGGCATTGATGTGATCGAGAAAATTAGTTGGGGAATAGATATGGGTACAGCTGTCAAC
TTAATGACTCTTCTTCCTAAAGATATGCCTATGAAAGCATAAAGTGATTTTATTGAGAAA
CGTTTGGTCTTTGCAATTCAATAGTAAGGAGATTAAGGTTATGATGTAAGAGAAGCCCTT
AAATTTATCATAAATGACAGAGAAAATCCAAGATTCAGAGACATAGATAGAGAATTAGCT
TAAATCATGCTCTAAGGAATCACTATGGTTAAAGATAATGTAGAGAGGCATTTTAGAGTT
CATTCAAAGGGTATTGGAATCTTTTGCAAGAGAAATGAAGGTATAAAAGCAAGCAACTTA
ATTATTGAGTATTTTGGAGAAATCTACTAGCCTTGGAATTGGTACGAAAAATAGGATGTC
TTGAAGCAAGGGCAAAATAAATAGACTTTATCAAAAGATCTTCCAGACTTTTACAATATC
ACTTTTGAAAGGCATCATGATGATCCCTAAGGTTATGATATTTTAATGGTAGATCCAATT
CTTTATGGAAATTATTCTTCAAGATTAAGTCACAGCTGTAACCCAAACTGTTCAACAATC
ATTCATGTTAGAGATAATCAGTATAGTATAGGCATGTTTGCTATTAAGGACGTTAGCTTT
GGTGAAGAACTGTGCTTTAATTACTGTTCACTTACTGAATCAGAAAAAGAATATGAATCA
GCTATTTGTCTATGTGGTACAGAAGTTTGTCAAGGCAAGTATCTTTAACTTGCAAATGAT
AAAAAGCATATGGCTATAATGAAAAAGTATCACACTTTTGTTGACAGAAACTACTTGCTG
TATAAAGCTTGTAAATTCCCTGAGATAACAGAAGAAGATGAAAAGAGATTAAACGATTTT
GGTATCAAGGAATCGGTTTTGAAAGATGTTCCAGACTGGCTGAAGAAATGGGCTAGTTTA
ATTTGTGAGTATATTATCTTTGAGGAAGATATTTACCCTTCATTTTTTAAGGAAATATAC
CCTACTTTCAAGGAAGAGGATTTGAGAATTGAAGCAAAGAATTAAAGAGACTCAAAAATA
TGGAATATTGCTATTACGATAGATAAAGTCATGCATGTGTTGAAATCAATGGGAGTATTT
GAACCACCTATAAAAGACCTTTCGTACAAAGAGAGGTGCATTAGATTATGGGATTCAAAA
GACAGTTTAAGAGAAAGCTTGATTGATGTCTTGAACCATATTGAAAACTATCCTGAAAAA
CTTGATGCTCTCTAGAAAGTAATTTCTGTTCCTCTTGTCGAAGCCTAATTTGACGAAGAT
GAAAACGGAAGATATTATAAGGAAAAATATTAAGAAATCCAATCAGTCATAGCTCTAATT
TCTGGTATTCTAAGGCCTATTAAATCGATAAAAGTTATGATTCCAGCATTATGTGATAGT
CTATGGCTCTATGCCAACACTCACACATATTTTACTCCAAACGAAAACTACAAGAAATGC
AAAGGAGATGAATAGAAAATCAGGAAATGCGATGTAAGAATTGAAAACTAGAATCAAGCT
TCACTAAATCCAGTTGAATAAGAAAAGCAAGTTTATAGAGGTTTCAAAGAATATGATCCA
AGTTATGTCTGGGGTTAGCTAGTTGGTTGGTACAAACAAACTGTTGATAAGCCAAATGCT
TCTCTAAGTGCAGATAGAAGAGGCACTCTATCAATGCCAGATTTGGAATCGTTTATAGTA
AGTGCTAAAAATCAAGACAATCTTAAAAGCGGGATTAAAAGAAAGAAGACTAAAAAGGGA
AGTGACGATGAGCAATAAGAAGAAATTTTGCCAACAAAGCAAAAGGGAACTAAGAGCAGA
CCTCCAATTAGTACCTAAGCGTCAGCTTGGTAGTTGTCGAATCAAGACAGCATATCTTAA
TTATCTGATTAGGGTACATCAGTTAAATATGCTTCTCAAAAAGACCCAAAGATTATTTAT
CCTCATAAAAAGCACTAGTCGAGGTCAGCGTTCTTAGAGAATTGGCCAGAAAATTTCTCT
AAATAGTGGGACGTTGTATGTCACTGGAGTTTTAAAAACAAAAATCGTATGTATGGAAGT
GTGTAATTTGAAAGTATATTACAATCAGATGTGGATAGAACCAGAAGGCTTTACTATTTC
CAAACAGTTCTAAATTATTTGAGAAATTAACAATGA


>Contig20227.0.g47(protein)
MITSQDQASNMSALQCNPSTYPQCYICSQQLQRDPSQGVQMCQTCKTQAHLSCLQNSQKI
KSNGEWRCDICIQQNQKMMTECFICCQPTSEQIQLAIFNEPHEISTGNLQQLEGLHSSVQ
NILTFGHEKCLIEKLPFTNQNLERRQPYQISRKDYINLKSAGRSQSQSPDRNSNKKSENG
SLTSDQNTIIQAQSTFQPQLTNQIPSQNQYKPANLQSLLARHPKNFQSFNHPTQSQNKNI
LSASSEAQITINGSQTDNSQFQQKQSNLYNQVRSDNFEQVQLKHNQSVIAVEQNQNFSNV
SIQSELVSQTDNQSETLTDYFQRRDFQAINQSASLQQHHSANFQSTNQGPLNQTAPPKLN
QNGVKIKLDLHTEKMIGKRQRSAGDNEMVKNTISKEQKEELKHDLDLIKQENQSVEDLNE
GNQNQSKERRSKNLENSPGQSSEMTKNKMLKALDADPSQFVVKEILTPILFQIDRLQFMR
RDKQKFEINLLNKDLKLLSKERREEILNTTSYLDIIEKPGQQKEVDLVFIIDQNLPQRLI
DSTRTSSNNQNDQQLNTVPLENTDINIQPNLDERQESDLLSAQDKNSELSPENEKMEVDN
DEESQEMKIRDSKIFEEEGFNITGGSDEQSKASSDCLSKKKKKKKSYGHSAKSKNLSKAL
LNLPSNLSDFTWIENTQLNKQLLEEEREKQIQLKKQKELERKSKQQDSESDLSADFSIKV
KQVTCEEDGLQLSETKLENQAKQDVEMIDTSTKIVEPPQIQKQVEQKPYDFKSKQGIQSI
DDIWERTDDGYYHSLDELLKDIEILVYLSFMLQRVNVLIKTKKEEFKFRWRNYYEAKYVQ
NDLYYPRIKGSWWKTPGAKREYNLIDNYKIMTPAEPSNKYLQGSQVYKQEIIRKMQTTKA
SKCQGACCLKIEDLGPFKLGSDVWESKCECRLARVECSKDCGCDPTVCQNRQMSQNQGLK
LGIDVIEKISWGIDMGTAVNLMTLLPKDMPMKAQSDFIEKRLVFAIQQQGDQGYDVREAL
KFIINDRENPRFRDIDRELAQIMLQGITMVKDNVERHFRVHSKGIGIFCKRNEGIKASNL
IIEYFGEIYQPWNWYEKQDVLKQGQNKQTLSKDLPDFYNITFERHHDDPQGYDILMVDPI
LYGNYSSRLSHSCNPNCSTIIHVRDNQYSIGMFAIKDVSFGEELCFNYCSLTESEKEYES
AICLCGTEVCQGKYLQLANDKKHMAIMKKYHTFVDRNYLLYKACKFPEITEEDEKRLNDF
GIKESVLKDVPDWLKKWASLICEYIIFEEDIYPSFFKEIYPTFKEEDLRIEAKNQRDSKI
WNIAITIDKVMHVLKSMGVFEPPIKDLSYKERCIRLWDSKDSLRESLIDVLNHIENYPEK
LDALQKVISVPLVEAQFDEDENGRYYKEKYQEIQSVIALISGILRPIKSIKVMIPALCDS
LWLYANTHTYFTPNENYKKCKGDEQKIRKCDVRIENQNQASLNPVEQEKQVYRGFKEYDP
SYVWGQLVGWYKQTVDKPNASLSADRRGTLSMPDLESFIVSAKNQDNLKSGIKRKKTKKG
SDDEQQEEILPTKQKGTKSRPPISTQASAWQLSNQDSISQLSDQGTSVKYASQKDPKIIY
PHKKHQSRSAFLENWPENFSKQWDVVCHWSFKNKNRMYGSVQFESILQSDVDRTRRLYYF
QTVLNYLRNQQ