Identifiers and Description

Gene Model Identifier

Contig20054.0.g96

Standard Name

None

Aliases

Contig20054_0_g96

Description

Hydroxymethylglutaryl-coenzyme A synthase C terminal

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam08540 ) Hydroxymethylglutaryl-coenzyme A synthase C terminal
  • ( pfam00368 ) Hydroxymethylglutaryl-coenzyme A reductase
  • ( pfam01154 ) Hydroxymethylglutaryl-coenzyme A synthase N terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006911803.9999205845932763e-156hydroxymethylglutaryl-CoA redu
ctase, degradat...
SGDYML126C6.001815994751712e-130ERG13 SGDID:S000004595, Chr XI
II from 20535-19060, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20054.0.g96(coding)
ATGGTTGAATAAAAGACACAAAGACATGCCCCACTTAAGGCAGAAAATGTTGGTATTATC
GCAGCAGAGATATACTTCCCATCAACCTATGTTTCACAAGACGACATGGAAACTTTTGAC
GGGGCTTCCAAGGGAAAATATACAATTGGTTTAGGTTAACTAGCAATGTCTTGCATCAAT
GACAGAGAAGATGTCAATTCTATATCACTCACATGTGTCCAATAGCTCTTAGATAAAAAC
TAAATCAAGACAAGCCGCATTGGTAGATTAGAAGTTGGTACAGAAACCTTGATTGACAAA
AGTAAAAGTGTAAAGACTACTCTAATGCAGTTGTTTTAAGGTAGCAGATCCCACGACATT
GAAGGAGTCACTTCCATTAATGCTTGCTATGGTTCAACTAATGCACTTTTCAACACAATT
AACTGGATGCAAAGCAATGCATGGGATGGTAATATTGAAATGCTATTAAAACTTTTATTA
GGGCGCTTGGGAATTGTGGTATCAGCAGATGTAGCAGTTTATGCAAAGGGATCAGCCAGA
CCCACAGGAGGTATCGGAGCAATAGCTCTCTTAATTGGTCCAAATGCTCCTCTGGTTTTC
GATGATGTGAGAGCAAGTTTTATTGACAATGCCTATGATTTTTACAAGCCTGTAATGAAT
AGTGAATATCCAACAGTTGATGGGCACTTATCAATCAATGTGTACTTGAATGCGCTTGAA
AATGCTTATAAAACTATGAAGGCAAAATGCAGACAGAGATATAATTGGGAACCTAAATAT
CAAGATTTCGACTATTTCTGTTTCCACACTCCTTTCTCTAAGATGGTTCAGAAATGCTAC
TTCAATTTGCTACTTTAAGACATCGCAGAATATAAAGAGAAGGTCTTTGATCCAGTACTA
GTTTAATAATTAAGAGAGCTAGAATTTAAAAATAATCCAAAGTCCCTTGAAATCTTGATG
AAAGCTTATGGGGGTGAATGGAAAGATAAGTGTGAGAGATCTCTTTTGTTAGCAAAATAA
TTGGGAAATATTTACACAGGTAGTTTATACAATGGTTTGATGTCTCTAATTGGAGATACA
TCCATCGATCTCAAGGGAAAGAGATTGATGATGTTCAGTTATGGATCAGGATGTGCGGCC
AGTATGTTTATGATTCATGTGAGAGGGGATTACAAACATATTCAAAAGACTAGTGAATTC
AAAACTAGACTTGAAAGCAGAATCAAAATAGCACCAGAGGAATTTGATAGACTTATGGCA
TACAGAGAGAAAATGTACGGAAAACCAAACATTGAACCACAGGGATCAATCGATCATTTA
TTCCCTGGGACCTTCTACTTAACAAAGATTGATGATAAATACAGACGGTTCTATGCAGTT
AAAGAAGGCAAGATGCAAATTATCAAACCTGAACTCTAACCAGTTGGCAACTTACTTGAG
AGCTCAAAGACTGCAAGAAGATTGAAAGCAGTCGACAACCAATTGAATGCCCAAGACCAG
CAATAAGTCGTTGCCAAGAACGACAGTTCAGTTCTTAAGTCAGTCATAACCAACTTCCAC
AAGAAACCTCTCTAAGAGAGATTAAATGAGTTGACCAAGATATACCCAGATTTAGACACT
GAAATGCTTAAGAAAGGGGGTTTGCAAACAGAAACAGCAGACTATATGATTGAGAATTGC
ATTGGTATATTGCCACTACCTCTAGGTCTAGGTTTAGGGTTCAAGGTTAATGGGTAAAAC
TATATTGTACCAATGGCACTAGAAGAACCATCAGTCATTGCCGCATGCAGTGCTATTGCA
AAGATTATTGGGGAGAAGGGTTCTGGGTTTATATGTCAAAGTACCCCACCAGTTATGATA
GCTCAAATTCAAATTACTGAGATCAAAGACTACCAAGATGCCATGTATAAGATTAAAATT
AACAAGAAGGATATTATTCAGCATGCTAACTAGTTTTGTGAAAATATGGTCAAGAGAGGA
GGTGGAGTTGAGGATATTAGAATCAGGTAGTTAGATAAGTAAATGATTGTTGTTGAGCTC
TTAGTAAATGTTTAAGAAAGTATGGGAGCAAATGTTATCAATACTATTGCAGAAAATACT
TCTCCCTATATTCAATAAATTATGGGTTAAGGTAGAGTAGCTGTTAGAATTTTGAGTAAT
TTATGCACTGAAAGACTTACTATGTCTCAATTTAAAGTTCCTATTAAAGCTATGTCTTGG
AAAAATGCAGAGGGCAAAGAAGTTTGTGAAAAGATAATTGAGGCTCAAAGGTTTGCAGAA
TTAGATTAATATAGAGCAACAACTCACAATAAGGGTATAATGAATGGAATAGATGCAGTT
GCATTAGCTTTAGGCTAAGATTGGAGAGCAATAGAAGCAGGTGCTCACTCTTATGCTTCT
ATTGGAGGAAGATACATGCCTTTAACTAGATATTTTATTGAAGGGGAATATTTTTGTGGA
AGACTAGAAATTCCACTTTCTGTAGGTGTTAAAGGGGGAGCAATTGAAACTAATCCATCT
TATATAAATACCCATTAAATTCTTGGGTTCCCTTCTACTTAACTCCTGGCTCAAATTATG
GTTTCAGTAGGTTTAGCTCAAAATCTTGCTGCTCTCAGAGCCTTAAGTATAGAAGGAATT
TAAAGAGGTCATATGAATTTGCATGCTAGAAACGTTGCTATTTAAGCTGGAGTTCCTCAT
GAACTAATCAATGACACAGTCGAGTTTATGAAAATGAGGAATAAGATTAATGTCAAAGCT
GCTTAAACTTATTTAAAGGGTCATGAGCTATTTAAAACACATCAATAGTAAAAGCAGATT
AAAGATCTAAGTACTTTCTACGTTGAAATAAGAGAAAGTTTCTTGCCTGAACCACTTATT
ATCACGATTCTATTAGATAGCAAGACAACAAAAAGAACTTATCATCTAAGTTTAGAAAAC
GATCCTAAACTTTCAGAATTTGAAGGAAAATTAAACAGATTACTCTTTGGCTGGGATAAG
GGGATCTAATGGATGACATCATTTTTAGGATTACTTAGATCTATAAGTTACAGTAAAAGA
ATACCAATAAAAAAAGACCTCATTCTAACTCAATATAGAATTAAAATGCTAACAATATTA
GCAAATATACTTATCACTAAGCTATTAGAGTTTGATTCCTTTAGTACATCTAACTTTGTG
TAAAAACTTGTTGAAATCATCAAATCAGGTGAACCTAGAGAGAAGTGTCATAAATTAATA
AGAGATCTGATTCCCACACCTGAAAATGAAGATACCGTTGAAAACTTAGTAAAACCTATT
GGTTTCTCACTTCTCTAAGAAATCACATTTAACTTGCTAGTTTATCTTGACGCGGACGTT
AACAGTCAAGTACTTAAGCAGCAAATTTATGATGAGTACCTTTTAATATTGACTTCCTTG
GTTACATCTCCATATCTTTACCAGGCAGCTTATAAATAGCTATAAAATGGTTAAAAGATC
AGTCTATAAGAACTCCATAATTACATGAGAGTAAAGAGCAAGAAAATGAATCACAAGATG
ACAGTTCTAGCTGATTGCATTGGTCTAGAAGAGCCTATTCCCAAGGAGCTTTTGGAATTT
ATCCAAGGAATGGCTTAAATTTACGAGTTAAAAGCTGTAGCATATAGAAGCCTCACTGTA
GCCCAAGATCTTCACGCTATAGCAGCAGATAATTTATTTGGTTACTGGTATTACTATAGT
AAGGGTTTGGAGGGAAGCCCTAGTGATCCAAATAATTTTGCATTGAAGGCTTAGTTCCTA
GATTTTATCGATGACTATTGCAATTCAATCATAGAATAGTATAAACTTAGAGAAAATCCA
TATTTTGATCAGAACTCGTTTAATGAGATCAATTAATTCATAGAGTAATATTATAAACTC
AATCCTTAGCTATAGTTAATGACTAAAAGGTCTAAATAGTCTTAAATGTAACAACAAACA
TTCAAAGCAAAATTGTGA


>Contig20054.0.g96(protein)
MVEQKTQRHAPLKAENVGIIAAEIYFPSTYVSQDDMETFDGASKGKYTIGLGQLAMSCIN
DREDVNSISLTCVQQLLDKNQIKTSRIGRLEVGTETLIDKSKSVKTTLMQLFQGSRSHDI
EGVTSINACYGSTNALFNTINWMQSNAWDGNIEMLLKLLLGRLGIVVSADVAVYAKGSAR
PTGGIGAIALLIGPNAPLVFDDVRASFIDNAYDFYKPVMNSEYPTVDGHLSINVYLNALE
NAYKTMKAKCRQRYNWEPKYQDFDYFCFHTPFSKMVQKCYFNLLLQDIAEYKEKVFDPVL
VQQLRELEFKNNPKSLEILMKAYGGEWKDKCERSLLLAKQLGNIYTGSLYNGLMSLIGDT
SIDLKGKRLMMFSYGSGCAASMFMIHVRGDYKHIQKTSEFKTRLESRIKIAPEEFDRLMA
YREKMYGKPNIEPQGSIDHLFPGTFYLTKIDDKYRRFYAVKEGKMQIIKPELQPVGNLLE
SSKTARRLKAVDNQLNAQDQQQVVAKNDSSVLKSVITNFHKKPLQERLNELTKIYPDLDT
EMLKKGGLQTETADYMIENCIGILPLPLGLGLGFKVNGQNYIVPMALEEPSVIAACSAIA
KIIGEKGSGFICQSTPPVMIAQIQITEIKDYQDAMYKIKINKKDIIQHANQFCENMVKRG
GGVEDIRIRQLDKQMIVVELLVNVQESMGANVINTIAENTSPYIQQIMGQGRVAVRILSN
LCTERLTMSQFKVPIKAMSWKNAEGKEVCEKIIEAQRFAELDQYRATTHNKGIMNGIDAV
ALALGQDWRAIEAGAHSYASIGGRYMPLTRYFIEGEYFCGRLEIPLSVGVKGGAIETNPS
YINTHQILGFPSTQLLAQIMVSVGLAQNLAALRALSIEGIQRGHMNLHARNVAIQAGVPH
ELINDTVEFMKMRNKINVKAAQTYLKGHELFKTHQQQKQIKDLSTFYVEIRESFLPEPLI
ITILLDSKTTKRTYHLSLENDPKLSEFEGKLNRLLFGWDKGIQWMTSFLGLLRSISYSKR
IPIKKDLILTQYRIKMLTILANILITKLLEFDSFSTSNFVQKLVEIIKSGEPREKCHKLI
RDLIPTPENEDTVENLVKPIGFSLLQEITFNLLVYLDADVNSQVLKQQIYDEYLLILTSL
VTSPYLYQAAYKQLQNGQKISLQELHNYMRVKSKKMNHKMTVLADCIGLEEPIPKELLEF
IQGMAQIYELKAVAYRSLTVAQDLHAIAADNLFGYWYYYSKGLEGSPSDPNNFALKAQFL
DFIDDYCNSIIEQYKLRENPYFDQNSFNEINQFIEQYYKLNPQLQLMTKRSKQSQMQQQT
FKAKL