Identifiers and Description

Gene Model Identifier

Contig20025.0.g87

Standard Name

None

Aliases

Contig20025_0_g87

Description

Vacuolar protein sorting-associated protein 26

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam03643 ) Vacuolar protein sorting-associated protein 26

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011240008.00275873087502e-68Vacuolar protein sorting-assoc
iated protein 2...
SGDYJL053W2.0008958828286524e-54PEP8 SGDID:S000003589, Chr X f
rom 335898-337037, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20025.0.g87(coding)
ATGGCAACGGCAGTTTCAGCCAATTCTCGCAGGGACAATTAGACATTCTCACAATCTAGG
CAGAATAAAATTAATCCCACTAATAGACCTACAACATAGTTTTCATTGAGTCCTTATCAT
TACTCTGGTGCTCAACCCATTATCAACAATAATAACATAGCAACGAGTGGATTTATATCT
GGGCAAGCTAATATAAACATCAATAATGGAGGTGTAGATGGCGGAATCAAGATTGGAGAC
GAAAGCAAGAAATCCTTCATAAATATTAATGGCCATCAAAGGAATACCAACATAGATATT
TTAGCAAGGAAGAGAAAGTGGGAGCAAGAAAAAAGAGGCACGCTTATAAGTGCTGATGCT
TCTAGATTATACCAAACTTCAAATAAGATCAATAACGAAATAGACAAGAGACTGTAAAAT
GGAATGCCCATTTAACAGAGAGAATCTCTTTAATCCAGACTGCTTGAGAGAATTACCACA
AAGAAACAAGCTCAAAACGAGATATATCTACAGGAAGAGATCTCAAGCGAAGGAGATGAG
GATGATGGAGAAACAACTAATCATCAAGTAGATGAAGAGGATTAAGAAGAAGACGATGAT
AATAAAACTACAGCAAGAAAGAGTGTTAATATGAACAACCGCAGTCGGAAAGGTCCCTCC
TCTGATAAAGTTTACTCACAAGAGTATGACGATGAAGAAAATGCAGCAGATATTGAAGAT
GCAGATAGGGGAGATGACGATGAAGAGCATTCTGGAAGTCAAGTTAGAAACCTCCCAAAG
ACAAATAAAAAGGGTATTTACAAGGAAGATTATGGAAATAGTGCAGTTGCTAATTAAGGA
GCTGGCGCACTTAATGGAGCTGACTTGAAGAAGAAATTCCATTTCTAAATCAGCTAAAAG
CAACAGTCTAGTACAGTATATGGGTCTAAATTCTTGGATTTCCGCAAAACATTCCAAAAT
ATTAATGCTAATTCTAATAAAGCATTGAATGCAAATATCTAAAACTAGTCTTCATCATAC
GGACTTCAATAAATATAAAATTAACAGTAAACTCAATAGCATTAATAATATACCACACAG
TATGGAACAGGCTTTGGTTAAAAGTCAAGTTTCTTACAGGAAGATTAATATGGAGGAGTC
GTTATAAATAACGGAAACTATTAAAATCATAGCTAGGTCAGAGGTAAGGCTGACAGCAAG
CTGGGGTAGGGTTGGCATAAGTTTGCAGTTACATCAAACAATTTTTATGATCCAAGAGCA
AATTAAAACAAGAATAACTTAGAAAATGGGGCACTCCAATAATCTCATTAATAACTGCAC
CCTCGATTCCATTCTAACAGGAGGGTAGAAGCCCCAACATAAAACCATCTCGCAAATGCA
AATAATTATGCTAACAAACCTTACAGTTAAGCTCCGAGTGGTACTGCTAATTTTGGTCGA
AAAACCTTCTATGTTAGTGATTATCAGAAATAAAAATAACAGCAAGAATTCTAAAAGTAA
TCAAGAGGTTAAAATCCTGCAGGAGCTCCCTATCACCAAATAGAAAACAAAAATCCAATG
TTTACTAAGCCTAGAGCCCTATCAAGACAGGCAGATGCCCACATTAAAATAGAAGTTCAT
AGAGATGAGAATATTAAAAATCACTTACAAGTAGAACAAAGAGAGAATATGAACTTAATG
TTCTATGATTTTAATGGTTCATCTCAAAATTAAAATAGTACAGGCCGTAGAACACTGTAC
AAGGAGATCGTTTGCCAACAAGAGAGCGAGGTTATCGTAGTGCATAATAAAACTTAAGAA
GGAGAATAGTTCCCTAAGCTAACTTAGAATAACCTAACTAGTATTAGGACATTTCTCAAA
ATGTATTTTGAACCCTTTAGCTCTTTGCTTGGATTTGCTCCACCAGTTAACATTCTTGTA
ATGTTCAATAAGATTGAAGGTAGAAAAATGGCTACTCTTAAAGACAGATCTGGGTAAACT
TACAAAGCACCAGTGTTTTTGGATGGAGATGACATCAAGGGAAAGATTAAAATTGAAATG
CTTAAGAGTAAATCCAGAGTGGACCACTAAGGCATCAGAGTCGAACTCATTGGTACAATT
GAAAATTAATACGATAAGAACTAGACTATTAATTTCATTCAACTTGGTTAAGAATTGGAA
CCACCTGGTGCTTTGATGGATTCTACAGAGTATAACTTTTCATTTAACAGAGTTGAGAAA
TAGTTCGAGACTTACAATGGTATAATTGTCAAGTTAAGATACTATGTAAATGTTGTGATT
AATAGAAGCTACAACAGAATCACTAAAGAAGAAGAATTTATTGTTTTCAATCCAATCCAA
GAACCAATATGGCCAGATAAGCCAATAAAAATGGAAGTTGGTATAGAGGACTGCTTGCAC
ATTGAATTTGAGTTCTCGAGATCTGTGTTTAATTTGAGAGATTGCATTCTCGGCAAAGTT
TACTTTAACTTAGTGAGAATTAAGATCAAGCATATGGAGCTGAATATTGTAAAGAAGGAG
ACTGTAGGATCAGGCCAAAATGCAATTACTGAGAGTGAAAATCTTAATAAGTACGAAGTT
ATGGATGGCGCACCAGTCAAAGGCGAGTGTATTCCTATTAGATTCTATCTTGTTTCCACT
GATCTTACTCCAACTTATGAAAATGTAAACAAGAGATTCTCAGTAAGGTACTATATTAAC
TTAGTTTTGGTGGATGAAGAAGATAGAAGGTATTTTAAACAGCAAGAAATATTCTTATGG
AGAGACAGACTTGCATGA


>Contig20025.0.g87(protein)
MATAVSANSRRDNQTFSQSRQNKINPTNRPTTQFSLSPYHYSGAQPIINNNNIATSGFIS
GQANININNGGVDGGIKIGDESKKSFININGHQRNTNIDILARKRKWEQEKRGTLISADA
SRLYQTSNKINNEIDKRLQNGMPIQQRESLQSRLLERITTKKQAQNEIYLQEEISSEGDE
DDGETTNHQVDEEDQEEDDDNKTTARKSVNMNNRSRKGPSSDKVYSQEYDDEENAADIED
ADRGDDDEEHSGSQVRNLPKTNKKGIYKEDYGNSAVANQGAGALNGADLKKKFHFQISQK
QQSSTVYGSKFLDFRKTFQNINANSNKALNANIQNQSSSYGLQQIQNQQQTQQHQQYTTQ
YGTGFGQKSSFLQEDQYGGVVINNGNYQNHSQVRGKADSKLGQGWHKFAVTSNNFYDPRA
NQNKNNLENGALQQSHQQLHPRFHSNRRVEAPTQNHLANANNYANKPYSQAPSGTANFGR
KTFYVSDYQKQKQQQEFQKQSRGQNPAGAPYHQIENKNPMFTKPRALSRQADAHIKIEVH
RDENIKNHLQVEQRENMNLMFYDFNGSSQNQNSTGRRTLYKEIVCQQESEVIVVHNKTQE
GEQFPKLTQNNLTSIRTFLKMYFEPFSSLLGFAPPVNILVMFNKIEGRKMATLKDRSGQT
YKAPVFLDGDDIKGKIKIEMLKSKSRVDHQGIRVELIGTIENQYDKNQTINFIQLGQELE
PPGALMDSTEYNFSFNRVEKQFETYNGIIVKLRYYVNVVINRSYNRITKEEEFIVFNPIQ
EPIWPDKPIKMEVGIEDCLHIEFEFSRSVFNLRDCILGKVYFNLVRIKIKHMELNIVKKE
TVGSGQNAITESENLNKYEVMDGAPVKGECIPIRFYLVSTDLTPTYENVNKRFSVRYYIN
LVLVDEEDRRYFKQQEIFLWRDRLA