Identifiers and Description

Gene Model Identifier

Contig1990.0.g4

Standard Name

None

Aliases

Contig1990_0_g4

Description

Casein kinase II regulatory subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam01214 ) Casein kinase II regulatory subunit
  • ( pfam06827 ) Zinc finger found in FPG and IleRS

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007805307.996458382256093e-94Casein kinase II regulatory su
bunit family pr...
SGDYOR039W1.0000844672813518e-48CKB2 SGDID:S000005565, Chr XV
from 405768-406544, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1990.0.g4(coding)
ATGCAACATAATCTATATGACGATGATGCGAGTGAATCGGGATCAGGCTGGATTTCATGG
TTTTGTGATTTAGAAGGCCACGAATTTTTCATTGAGGTTGATGAGGACTATATAAGGGAT
AATTTTAACTTGCACGGTCTAAAAGAGCGCATTTAATATTTCAATGAGGCTATGTAAATG
ATTCTAAGCGCTGACAGTCCAGACTCAGAGGACCTTAATGATTAAAACTTCCTTGAAATA
TATCAATCAGCTATGGATTTATACGGACTAATTCATGCTAGATTTATCATATCGCCAAGA
GGTTTAGCTTTAATGAAGGAAAAATATATGTTGGGATCTTTCGGCTACTGCCCAAGAGTG
TTATGCGAGCGTCAAAACATCCTCCCCATCGGTGTATCCGAAGAGCTGTCTACTTCTAGA
GTGAAAGTTTACTGCCCAAGATGCCAAGATGTATATATTCCAAGACAAAAACAGTTAGAT
ATTGACGGTGCATATTTTGGCACCAGTTTCCCTCATGTCTTCTTAAAGACATACACAGAG
CTGATTCCACAAGGCCCACCCAAGTTCATTCCCAAGATTTATGGGTTTAAGATTTTTGGG
ATGAGAGGATCTAAATTTGAGCTGAGGTTTGATTATAAAGGGCAACCCATTAACGAAGAA
GAGATAAGAAATGTGCTTAAGAAGGATAAAAGAAATGTGGCAAATAAAAAAGATGAAGAG
GAGAAAATGAGCTTCTGA


>Contig1990.0.g4(protein)
MQHNLYDDDASESGSGWISWFCDLEGHEFFIEVDEDYIRDNFNLHGLKERIQYFNEAMQM
ILSADSPDSEDLNDQNFLEIYQSAMDLYGLIHARFIISPRGLALMKEKYMLGSFGYCPRV
LCERQNILPIGVSEELSTSRVKVYCPRCQDVYIPRQKQLDIDGAYFGTSFPHVFLKTYTE
LIPQGPPKFIPKIYGFKIFGMRGSKFELRFDYKGQPINEEEIRNVLKKDKRNVANKKDEE
EKMSF