Identifiers and Description

Gene Model Identifier

Contig19826.0.g53

Standard Name

None

Aliases

Contig19826_0_g53

Description

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00160 ) Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
  • ( pfam04641 ) Replication termination factor 2
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam04564 ) U-box domain
  • ( pfam07176 ) Alpha/beta hydrolase of unknown function (DUF1400)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007720402.9988601762256104e-132peptidyl-prolyl cis-trans isom
erase, cyclophi...
SGDYLR216C1.9994920269952867e-34CPR6 SGDID:S000004206, Chr XII
from 573211-572096, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19826.0.g53(coding)
ATGGGCAAGAAGAGACATGCTTAGGATAAGATGTGGATCACCTACGCAGAATTAACTAGT
GAATGGGGTGGCAAAAAGGAAGAACATAAGAGTAAGAAAGAAGAGTATGTGAAGATGCCA
TTTTACTACTGCAACTTATCAATGGGACCCTTTGTTGATCCTTACTGCACTGATGATGGA
ATTATCTTTGATCTACTCACAATTATTCCCTACCTGCGTAAATACAAAAAGAATCCCATT
ACAGGAGCACCTATGAAAGAAAGTGACCTGATAAAGCTTAACTTTCATAAAAATGAGCAA
GGAGAGTATCATTGCCCTATTACTTACAAAACATTCACTGATCATACTCATATTATAGCT
ATAAGAGAAACTGGAAATGTGATTAGTTTTGAAGCTTTTAATGAATTAAATAAGGAACCA
CAGTGGTACTTTGATTTACTTACAAACGAGAAATTTGACCCCAAGAAGATAATTACAATT
TAAGACCCTAAATCCCCTGGTAGAAAAGTAAATCAATATCATTACAAGCAAAACAATGAG
GACATCTAATAACTCCTTAAAGAAAAATCATAGAAGAAAAAGGACGAAGGAAATTAGTTC
ATCAATCAGCCTATAGCTGGAAAGAGAATACTAGATGAATTAAAGCAATCCACTTAAGCT
AAATAAGACCAGTCTAAAAATAGCACAAACACTAAATTTGCATCTGGTTCTGAGTTCTTT
AAGTCGTTTGAAGTTGAACCTGAATTAGAATCTTTGAGAGTAGAACCAAAGGTTTACATT
GAAAAGAGGGTAAAAGAGGGCAGTAGACTGCATAATTCAAGTACTGAGGGATTAACTAGC
AGTGGATTTACAAGCACTAGGTATGAACCAGTTACCAAGAATGTAATGAGATAGTTGTCT
GATAATGAAATACGCAAGGACTACTATAACCCAATAAAAAGCAAATAATTAAAAGGCAAA
GTATCTCTAGTGACAAACTATGGCACAATGATTATTGAGATACATTGTGATAGAGTACCA
AAGACTGGAGAGAATTTCCTAGAGTTATGTGAAAATAAATACTTCAAAGGAACTAAGTTT
CATAGACTAATCAAAGGCTTTATGATACAAGGAGGAGATCCTGATGGCACTGGTAGAGGA
GGCAAATCATATTTTGGAGAGAAGTTTGAGGATGAGTTTCATCCATCTATACCACATATG
GGTAGAGGAGTGCTCTCTATGGCTAACAGTGGGGAAAACACAAATGGCTCCCAGTTTTTC
ATAACTTTCAAGTCTTGCCCACATTTAGATGGAAAACATTCAGTCTTTGGTAAAGTGATT
TAAGGGCTCGAATTCCTTGATAAAGTTGAAAATATGGCTGTAAACTCGAGTGATATGCCT
AAAGATGATATTAAGATAGAAGATACCATAGTCCTAGTGAATCCCTATAGAGACACCATT
GCAGAAATACTGATGAAGGAATGGAAGAAAAAGCATTTGGAGCATTTGCAGAAGAAGGAC
TAGGATGTCAAGTGGACAACATTAAGCGGCTTTAAGAAGACATAAGACACTAATTAGGGT
GTTGATACCATAGGAAAGTATATCAAAAATTCAACTAGTTCAAATGTTAATCCAGGAGAC
AAAATTAAAAGCAGTGTAGAAACAAAACCAGTATAAGATTAACATAATAAATGA


>Contig19826.0.g53(protein)
MGKKRHAQDKMWITYAELTSEWGGKKEEHKSKKEEYVKMPFYYCNLSMGPFVDPYCTDDG
IIFDLLTIIPYLRKYKKNPITGAPMKESDLIKLNFHKNEQGEYHCPITYKTFTDHTHIIA
IRETGNVISFEAFNELNKEPQWYFDLLTNEKFDPKKIITIQDPKSPGRKVNQYHYKQNNE
DIQQLLKEKSQKKKDEGNQFINQPIAGKRILDELKQSTQAKQDQSKNSTNTKFASGSEFF
KSFEVEPELESLRVEPKVYIEKRVKEGSRLHNSSTEGLTSSGFTSTRYEPVTKNVMRQLS
DNEIRKDYYNPIKSKQLKGKVSLVTNYGTMIIEIHCDRVPKTGENFLELCENKYFKGTKF
HRLIKGFMIQGGDPDGTGRGGKSYFGEKFEDEFHPSIPHMGRGVLSMANSGENTNGSQFF
ITFKSCPHLDGKHSVFGKVIQGLEFLDKVENMAVNSSDMPKDDIKIEDTIVLVNPYRDTI
AEILMKEWKKKHLEHLQKKDQDVKWTTLSGFKKTQDTNQGVDTIGKYIKNSTSSNVNPGD
KIKSSVETKPVQDQHNK