Identifiers and Description

Gene Model Identifier

Contig19816.0.g9

Standard Name

None

Aliases

Contig19816_0_g9

Description

Spc97 / Spc98 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012203402.0006597401342834e-129Spc97 / Spc98 family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19816.0.g9(coding)
ATGCTACACGAATTGTTATTGGCTTTATTCGGACACACAGGAAGTATAATTCAAGAAGAC
CAAGATGGGTTTGTTGTAAATCCAAACCTAAATTTCCTCTCATAAGCAGAAATTGAAATG
ATTAATAGAATTTCATATTTGGGATTCCTATTCAAGTAAATACAAAGCTTCTTGCATAAA
TATGGCGGAATTTCAACCAAATTAGCCATATAATTAGCTTACAATGACTTATATCAGAAT
GAAAAGATAAAGGATTAACCTAATCAAAATCAAAATTTGGATTTATCATAGAAAAGTGAA
GTTGATGAAGAGCAAGATTAAGATGAACTCTTTGGAGTTTATATAAAAGCTTTCTGCAGT
GGAGTCAATGAAATTATAACCACATATAAATAACACTTACTTTCGATTGAGCATGAATAT
CTTAAGGACAGATCACTTACAATTCCATCACTTTAGCAAAAGTTAGCGATTTACTAATAA
ATCTTTCCAGCAATCCTTAGCTTTATGCAAAATATTGAAGAGTAGAATTTAAAGGGAGGT
CAGTTACTTGATGCTATTTATCAAAGTTGCACAACTGGAAATCCTGTGATAAAAAGCATG
TTCAATAAAATTCTGTTTTGCTGTCATAGGGTGCTTTTTCTTCAAATTAATGCTTGGATA
GTTCATGGTCAACTAGTCGACTTATGTGAAGAATTTTTCATTCATAAGATAAATAACTCA
AATTAGTCTATGGGAAAGAATTAAGAGGGAGGTGAAGAATCAAAACTTAATTAAACTGTT
AATTCCATAACAAGCATTTCAAATATAAATTTGGTTGGGTCCATTTTAACTATGGACCCA
GAATCTTTTGGTGCTGACGATGAGACAAAAGATGATGAGTGGAACTCAGTCTATACTTTA
AGAATTTCTATGCTTCCTTGCTCATACTTTCCACCTTCACTAGCAGAGAAAATTTTATTC
ATCGGCAAAGCAGTAAGAGTCCTTTAATCGAAAAAGACTTAGTTAAGTGATAGAATCCCA
ATACAAGATCTTGAAGCATTCTCAGAAGCAATAATGAAACTCCAAAAAATGCCTGAGTTT
AATGTTCTACTAATATCAAGAATAATCGAAGAAATGAGAGAAAGTATTGCAAGTAGACTT
CTTCATTTAGTTGTCATTAAGGCAAATCTGGTTGAGCATTTAAGAGAAATAAAAAATTAC
TTCTTAATTTCAAAAGGAGAGTTTTATCAAACATTTCTGGAAGAAGCAAGATAAATAATG
TCCCTCCCTCCTTAAAGTTCTTCAGAATTTGATTTGAATGTAGGTCCTCTTCAATAAACA
ATAATCAAATTAGGACTTGAAGATGATGCATATCTAAGAAGTGGATTGTATTATATTGGA
GATGTGCATATTGACATAAAAAAGAATTACTCATTTAGAATTAGATCATAAAAAACTTCT
AGAAAAAGTGGCGCTCTGTGGCATTGCTTGAAACAAAGATTAGATATGGGTTTCAAGACT
ACTTTTGCATTCAAATTTAAAAACATGTTGATTAATGGAGGAGGATAAGGCATGAATGCA
AGTATCATTAGTGGTTCAGTTATGGGTTCCCCAGCTAAAGGCTCAAGAAATTATATGACA
AATGACTAGAATTCAATAATGGGTCCTCCAGGCGGTAGAAATACTCAATTCGGAAATCAT
AATTACAACTAGACAATGGGAAGCTTTGCTGGGGATGAAAGCTAGAACTTAGGCTAGTTA
GCAAATAACTTAGGCCAGGATTCAAAGATATAAGGTGCCTTGTGTTTTATTATATAAAAC
GAAAAAGAAGTTATCCCATGGAAGAGAACCACACCTATGGGAACATCAGATTTAAATTCA
TTCATTAGTGTAAAGTTTTTGACTAAAATTTAGAGTGTTGGTGGTCAATTAAACTAAAAT
AGATTGAGTATACTCAGACAATAATTTTAAACTTAACATTTAATTCAAGTATGGGCTTCT
ACAGAGACATCGATTGGTAAAATAAAAACTATGATTGATGATAATAATCAAAATGTTTCC
ACAAAGAATGAAATTCTGTTGGAAGAAAAAGATGTAACAAATGAAATGGATTTTATGGAT
AATGATTCTCATCAAATTTAACTGGAGTACTCTAATGATGAGCTTAGAGTTTTTGTAATT
GATGGAACAAGTCAATAAAACTAAAATAAGATCTAAGTGATGAACTTAAACTTGAAGATA
AGTGATTATGTAAAGCTTGATAACGGAACTGCATATTTAGGATTCACTCATGAAACTTTA
AATCTGCCTAACTTATTGTATATTGAAAACTGGACTTTTATATCTGAAGCTAAATCAAAT
TAACAAGATCCTTGGAATGGTCTGTCTTTAGATTACAGATCTCACTGGCCTTTACATTTA
ATGTTCAGCCCAGATGTTATAGAGAAATACAACACTCTCTTTAGATTTCTTCTACCAATC
AAAAGAATCTAACTTGACTTACAGCATGTTTGGGCTGTCAAAGTCAGATTGATGAAGTAA
TTCTCACACATACCTGCTTTCAGAAAGACTATGCTACTACGTTAACACATGAGCTTTTTA
GTAGACAATCTGTTTTCTTACCTTTAAGTAGATGTACTAGAATCCTAGTGGACAAAGCTT
GAGAAAGGTATAAACATAACTCAGGACTTTGAGGAAGTCAGATTACTTCATGACAAATAT
CTTTTGAGTATCACGGAGCAATGCTTTTTAAATAACAATCAAGTGCTTAAAGTAATACAA
GATGTTATTCATATGTGTATGCTGATGTGCAAACTATTGAAATAGCTGGATGTTTATAAT
CATGAAGCAGTTGAAGATGAATTTGATAAGATAAAAAGTAACTTCGAAAACTAAAGTAAT
AAAATGTTTAAATTGCTATCAAACTTCAAAAATTACCACCAGAGCTCCCCATATCTTGCT
CAACTACTTTTAAGACTTGACTACAACAATTACATGAGCAATTTATCAGAAAAGATTGAG
AATGAGAGAAATATGATGTTGCTAGGTAATATGAGACAATAGTAGCAAATGCAATCTCAG
CACTAATAATTCCAAATGCAATAGTAGTTTCACTATAGATGA


>Contig19816.0.g9(protein)
MLHELLLALFGHTGSIIQEDQDGFVVNPNLNFLSQAEIEMINRISYLGFLFKQIQSFLHK
YGGISTKLAIQLAYNDLYQNEKIKDQPNQNQNLDLSQKSEVDEEQDQDELFGVYIKAFCS
GVNEIITTYKQHLLSIEHEYLKDRSLTIPSLQQKLAIYQQIFPAILSFMQNIEEQNLKGG
QLLDAIYQSCTTGNPVIKSMFNKILFCCHRVLFLQINAWIVHGQLVDLCEEFFIHKINNS
NQSMGKNQEGGEESKLNQTVNSITSISNINLVGSILTMDPESFGADDETKDDEWNSVYTL
RISMLPCSYFPPSLAEKILFIGKAVRVLQSKKTQLSDRIPIQDLEAFSEAIMKLQKMPEF
NVLLISRIIEEMRESIASRLLHLVVIKANLVEHLREIKNYFLISKGEFYQTFLEEARQIM
SLPPQSSSEFDLNVGPLQQTIIKLGLEDDAYLRSGLYYIGDVHIDIKKNYSFRIRSQKTS
RKSGALWHCLKQRLDMGFKTTFAFKFKNMLINGGGQGMNASIISGSVMGSPAKGSRNYMT
NDQNSIMGPPGGRNTQFGNHNYNQTMGSFAGDESQNLGQLANNLGQDSKIQGALCFIIQN
EKEVIPWKRTTPMGTSDLNSFISVKFLTKIQSVGGQLNQNRLSILRQQFQTQHLIQVWAS
TETSIGKIKTMIDDNNQNVSTKNEILLEEKDVTNEMDFMDNDSHQIQLEYSNDELRVFVI
DGTSQQNQNKIQVMNLNLKISDYVKLDNGTAYLGFTHETLNLPNLLYIENWTFISEAKSN
QQDPWNGLSLDYRSHWPLHLMFSPDVIEKYNTLFRFLLPIKRIQLDLQHVWAVKVRLMKQ
FSHIPAFRKTMLLRQHMSFLVDNLFSYLQVDVLESQWTKLEKGINITQDFEEVRLLHDKY
LLSITEQCFLNNNQVLKVIQDVIHMCMLMCKLLKQLDVYNHEAVEDEFDKIKSNFENQSN
KMFKLLSNFKNYHQSSPYLAQLLLRLDYNNYMSNLSEKIENERNMMLLGNMRQQQQMQSQ
HQQFQMQQQFHYR