Identifiers and Description

Gene Model Identifier

Contig19750.0.g98

Standard Name

None

Aliases

Contig19750_0_g98

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004333909.997093137033517e-262Cyclin, N-terminal domain cont
aining protein
SGDYBR160W3.00039543526891e-44CDC28 SGDID:S000000364, Chr II
from 560078-560974, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19750.0.g98(coding)
ATGAGTTTTTCTCCACCCAAACTAGATCAGTTTTAATCATAAGTTTCATCACAATAAAAT
TACGGTAGTTACTAACAACAAGACGCAATGATGCAAGATGCAAACATGAACATGAGTGAT
CAACTCCCTATGGGGGTCCTCTACCCAAACAACTAAATTGCGAATCAGAATTAACTTGCT
CTACATCAGCAGACAATTGGAAGCAATTCGTACAATGGAGTGAGTTAATCATTGCGACAC
AACATTAACCAGAAGAAACAATTCAACAAGAAAATTATGTTTAATCAAATCGACCAGGAT
AGCATCATGAATGATTATGACTCTGAAAATATAGACCCAAACATGCTTTTAATGATGGGA
GACATGAAAGGTGGCCTCATCAAGCAAAAATAAGTCCGCAAACAATTACATCAGCCAGAT
CTCAAGATTGCCGATAAACTAGGTTAACTCCTTCCTTATGAGTTGTAACTTATTGTGACA
TGGTACTTGACACCAAAAGATAATGCTATCATCATGAAAAGTTTGTCTAAGTACTGGCAT
GATTTAATCAAGAAAAACAAATACTGGGAATTGTATGATAAAAAGAAGCAACTAACAATT
AATGAAAGACTTCAAATCGTGCAATGCTTAGTTGAGAGGAGATCTAAAGGTAAACTATAC
AAGGCTATTGATAGAGTCACTAATGAAACTTGTCTTCTCAGGAAAATATTTTTGGATGTT
ACTAATGCAGGTCAGGATGATGGTATTCCTACTAGTGTTCTCAGAGAGATTTCACACTTA
AAAACCTTAAATCACTAGAACATAGGTAAAATAAATCATGCGGAAGTGAAAAATGAGCTA
GCTCAATTAGTCTACGAATTTCATGATCAGAATTTGAAGGAATACGTTCGTAAAAATTCA
TAAAATTCGATGACTCTACAAAGCATAAATGGTCGTCCAAGAACTGAAAAAGTTATGCAC
TTTTTATCAAATGAAAAAACGAAAGGTATAATCTACTAGGTCTTATAGGCAATTTGTTTC
TCTCACAGAAACGGCATTATGCATAGAAATTTGAAACCCGATAACATCATGATAACTAAG
GATGAAGTTGTTAAGCTTGTTGATTTTTCATTGAGTAGAATTGCCGCTATACCACATTTC
CCTTATACACCAGAAGACCCTAAAGAGCGTGAAAGATCAGGTAGAGAGGCAAGACGTCTT
TGGTATAGAGCTCCAGAATTACTTTTTAGAAAGCAAATGTATTCTTTCGAAGTTGACATT
TGGTCAATAGGCTGTCTATTTGCTGAACTTTAACTTGGCGAGGCGCTGTTTAACGGAGAA
TCAGAAATTGAACAACTTTTTAAGATATTCAGATTCACAGGATCTCCTTCTTAAGAAGTT
ATCGATATCATGAGACATGGAACAGAAAACGAAATAGTCAATTTGCCATTTTGGGAAAGA
GTTCATTTTGGTAATGTTTGCTATCCTAAGGACTCTCAAGAAATGAAAAATATTGTAGCT
GCATATATTCCATCAAGAGAAAGTAGTCTTATGAAACTATTTGACCTCAAGGACAAAATG
GGTTATGAAGGTTTAGATTTGCTATTTAGACTATTAGATATAAATCCTCAAACTAGAATC
TCTGCAGAACAAGCAATATAACATCCATTCTTTGATTCTATTCGCTAATTAGAAAATAAC
TTGAAGTACGACTACTCAATTATTCCACTAATTGAAAACTATCATGGCGATATTTCTCCA
AGTCACTACAAATATATTGCCTCAAACATGCATGAAAATGAAATCAAGCTTATGCCTAAT
GGCAATCTTATGTCTATTTAAAAGCAGATTACTGATAACATGAGATCAATCCTAGTTGAC
TGGCTTGTTGATGTTAGTGTTCATTTCGAAGTTATGAATGAGACTCTACATTTTGCTATT
AATTACATTGATAGAACCTTATCAAAGCTAGCAGTTGAAAAGAAGTAGCTGCAGCTTGTC
GGTGTTTCATGTATGAAAATTGCAGATGTCTTCAATGAAAGATCAAAGGAATACTATAGA
TAGGAAAATTCAACTGAGTATGCTTATATTACTGCTGACGAGTACACTGCTCAAGAAGTC
ATAAAAATGGAGAAAGAAATTCTTAACTTGCTCAACTTTGAACTTTACTCACCAACTTCA
GTTTCTTTCTTAAAGCTATATTACTAAATTTTGCAAAGCCTTGATTAGAGCACAAAGATA
TTATCTTAATATCTTGCAGATTTGATACTTCTTGCAGTCAATTAGCATTAGTACGAACCG
AGTATGCTTGCTTCAGCCTACCTTTTGATTGCTATGTAAGCTCAAGAAATTCCAATGGCA
ACTATCAATCAAGATTAAATGAACAGATTCAGGGACATCTATGTGTAATGGTACAATTAC
CCACAATTCAAGAAATGTGTTGACTTTGTCATGACAAGTTGGTTAGAGAGCAGACACAAC
CCTAACTTTTCAAGATTTGATGCTGTTAACAATAAGTATGAGTAATTTATTGAAACTATA
AATATTAGATAGCTACATCCACCCATCATACAAGCTAGAGTTATTGAAGAGTGGTTTAAC
TATCCCCAATATGAAGAGACTCACTAAAATAACTTCTTGACTAACATGAATCTAGAAAGC
AATAACTTTAGTCCAGGCTCATAAAATGATTATCTACAATAAATTGAAGGCAATCAATAT
CCAGACTAATAAGAAGAATTACAACCATAATAAATGGAGTTATGTTGA


>Contig19750.0.g98(protein)
MSFSPPKLDQFQSQVSSQQNYGSYQQQDAMMQDANMNMSDQLPMGVLYPNNQIANQNQLA
LHQQTIGSNSYNGVSQSLRHNINQKKQFNKKIMFNQIDQDSIMNDYDSENIDPNMLLMMG
DMKGGLIKQKQVRKQLHQPDLKIADKLGQLLPYELQLIVTWYLTPKDNAIIMKSLSKYWH
DLIKKNKYWELYDKKKQLTINERLQIVQCLVERRSKGKLYKAIDRVTNETCLLRKIFLDV
TNAGQDDGIPTSVLREISHLKTLNHQNIGKINHAEVKNELAQLVYEFHDQNLKEYVRKNS
QNSMTLQSINGRPRTEKVMHFLSNEKTKGIIYQVLQAICFSHRNGIMHRNLKPDNIMITK
DEVVKLVDFSLSRIAAIPHFPYTPEDPKERERSGREARRLWYRAPELLFRKQMYSFEVDI
WSIGCLFAELQLGEALFNGESEIEQLFKIFRFTGSPSQEVIDIMRHGTENEIVNLPFWER
VHFGNVCYPKDSQEMKNIVAAYIPSRESSLMKLFDLKDKMGYEGLDLLFRLLDINPQTRI
SAEQAIQHPFFDSIRQLENNLKYDYSIIPLIENYHGDISPSHYKYIASNMHENEIKLMPN
GNLMSIQKQITDNMRSILVDWLVDVSVHFEVMNETLHFAINYIDRTLSKLAVEKKQLQLV
GVSCMKIADVFNERSKEYYRQENSTEYAYITADEYTAQEVIKMEKEILNLLNFELYSPTS
VSFLKLYYQILQSLDQSTKILSQYLADLILLAVNQHQYEPSMLASAYLLIAMQAQEIPMA
TINQDQMNRFRDIYVQWYNYPQFKKCVDFVMTSWLESRHNPNFSRFDAVNNKYEQFIETI
NIRQLHPPIIQARVIEEWFNYPQYEETHQNNFLTNMNLESNNFSPGSQNDYLQQIEGNQY
PDQQEELQPQQMELC