Identifiers and Description

Gene Model Identifier

Contig19730.0.g30

Standard Name

None

Aliases

Contig19730_0_g30

Description

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005481308.003434702148559e-116peptidyl-prolyl cis-trans isom
erase, cyclophi...
SGDYDR155C6.999507172836373e-51CPR1 SGDID:S000002562, Chr IV
from 769000-768512, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19730.0.g30(coding)
ATGGAAAAAGTTTTGGACGAAATACATCTGACCTCAGATTCAGGAGTCATAAAGAAAATC
TTAAGATTTGGTTCAGAAAGTGACCCTACTCCAGAAAAGAACCAGGAAGTCACTGTTAAC
TATGAAGGCAGACTAGAAGATGGTTCAATTTTTGATACTTCAAGAGACAGAGGAGAAGCT
CTTAAGTTCATTATTGGGTCTGGCTAAGTCATTAAAGGGTGGGATATTGGCATAATTTCA
ATGAAGCTAGGAGAGAAAGCAGAGTTACATATCAAGCCAGAGTATGCTTATGGTCGTATT
GGCGCTCCACCTAAGATCCCAGGGGATGCAACTTTGATATTTACAGTTGAAGTTATCCAG
ATTAATGATCGTAAGCCAACCAGATGGATGATGAGTGATCCAGAGCTCATCAAAGTTGCA
CTTAGATTTAAAGATGATGGCAACCTGAAATTTAAGGCTCAAAAGTTCAAGGAAGCAGAA
GGATTGTACAGAGATGCATTGGCTCATCTTGATACAGTTAAGAATGATAATAAGGAATTG
AGAGATTTGAAGAAAACTATCTTGTTAAACTTATCAGTTGTGACAAACAACACTGGTGAT
TATAAGGAGACCCTGATTAACTGTACCAAAGCTCTTGACTTAGATGAGAAAGCAGGGAAA
GCTTATTTCTTAAGAGCCCAAGCAAATTTAAAGCTCCACCAATATGATGAAGCAATTGTT
GACATAAAAGAAGCTATTAAGATAACCCCTTCAGACAAGAAGTTAAGGGATGAATTTGAA
ACTATTAAAGCTCATAAAAAGAAATATTTGGAATCACAGTAGAAATCACTTCAAAGTTTC
TTTGCACAAGGGCTTTACAATGAGAAAGAGGCTTAAGTCACTAAAATTGAAGATAGGCTA
CCAGAGTATGATCAGTCAAACCCATAAACATATTTCGACATTGAGATAGGGGAAGAAGGG
CAAGAAAATCATAAGAAGGGAAGAGTGGTATTTGAACTGTTCAAAAATAAAACTCCAAAA
ACTGCTGAAAACTTTAGATGTCTCTGTACTGGCGAAAAAGAACAGAATTTGCATTACAAG
GGAAATGTCTTCCATAGAATAATCAAGGGTTTTATGATGTAAGGGGGTGACATAACAAAT
TAAAACGGAACAGGTGGAAAAAGTATATATGGATTCAAGTTCCCTGATGAGAAAATTTGG
CTACCACACACCCATTCTGGTTTACTATCAATGGCAAATTCAGGTCCAGACACGAATGGT
TCACAGTTCTTCATAACCTTTAAATCCACTAAATGGCTTGACAATAAACATACTGTTTTC
GGGAGAGTCATTCATGGTATGAATATTTGCAGAGATATTGAATAAATTGAGACTGGAGCA
TAAGATAAACCATTAACTACTGTCAAGATTGTAGATTGTGGGGAACTACATGGCGTCGAA
AAGTTAACAAACGAAAATGCAGACAACCTAAAAATTTACACTTAATCAGAATGTGAAGAG
GAGACTCCCATCAATTAAAGAGTTATACTTTGA


>Contig19730.0.g30(protein)
MEKVLDEIHLTSDSGVIKKILRFGSESDPTPEKNQEVTVNYEGRLEDGSIFDTSRDRGEA
LKFIIGSGQVIKGWDIGIISMKLGEKAELHIKPEYAYGRIGAPPKIPGDATLIFTVEVIQ
INDRKPTRWMMSDPELIKVALRFKDDGNLKFKAQKFKEAEGLYRDALAHLDTVKNDNKEL
RDLKKTILLNLSVVTNNTGDYKETLINCTKALDLDEKAGKAYFLRAQANLKLHQYDEAIV
DIKEAIKITPSDKKLRDEFETIKAHKKKYLESQQKSLQSFFAQGLYNEKEAQVTKIEDRL
PEYDQSNPQTYFDIEIGEEGQENHKKGRVVFELFKNKTPKTAENFRCLCTGEKEQNLHYK
GNVFHRIIKGFMMQGGDITNQNGTGGKSIYGFKFPDEKIWLPHTHSGLLSMANSGPDTNG
SQFFITFKSTKWLDNKHTVFGRVIHGMNICRDIEQIETGAQDKPLTTVKIVDCGELHGVE
KLTNENADNLKIYTQSECEEETPINQRVIL