Identifiers and Description

Gene Model Identifier

Contig19661.0.g109

Standard Name

None

Aliases

Contig19661_0_g109

Description

Dynein heavy chain and region D6 of dynein motor

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006884709.997093137033517e-262Dynein heavy chain family prot
ein
SGDYKR054C9.997093137033517e-262DYN1 SGDID:S000001762, Chr XI
from 547925-535647, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19661.0.g109(coding)
ATGGACGAAGATGAAACATATCAGAGACTTACTGGTCTCTCATCTATGATTCAGCAAGTC
TACTTGCCACTTATGGAATCCAGAACGGAGACTCGTCTTCAGATGGAGAAATTTGTGAGG
TAGATTTCGATTTCTTTGCAATAAGCCTATGGCAATGTCACGATTAAGGTGCCTTACGTG
CCTTAGGGTGTCTCTGATGAAGAAATATGTCGAAACCGCTCACTCATAGAGGAGTACTAG
AACACTATTGAAGAGTGGGCTAATACCATAAAGGAAACTATCGACAGAGAGAAAGATCGT
CAGAAGGAAATGAACACTGCCTACGGAGAAGTTGAGTACTGGAGATCAAGATCAGCAACT
TTCAACACTCTCTACCAGCAACTCACCATGCCTCAAGTCAGGAAAATCATTCAGATTATG
GTTGCTAATGAGACTTTGAACTAAGATGCCTTCAGTCTGGAGCACTTCAATTCACAATGG
GCTAACTTCTCAAAGCTCCATGCATAAGCTAAGGACTTCGTTAAGTTTTTGACCACTCTT
GAGCGTCAATTCAAGATCATCACCCGTGGAGAGTTGAATGTGATTGAGGAGACTCTTCCT
TCTCTACTCAATGGTTTGAAGTTAATCTGGACTATCTCTCGTCACATCAATCAGAATGAT
TCTAAGATGGAAGACTTACTTGAAAGCATCAGCAATGAAATCTGTGAGAAAGTCAGAGCT
CAAATCGACATCAGAAGGATCTTCAAGATCAACCCAGCAGTTGCTATCAACACAATCACT
CAAGGCATCAGTGTCCTCGAGAAATGGCAGCAGCAATTCATCAAGACCAAAATGGAGATT
GAGTCAGAGTCAACTGTAAAGAGATGGGACTTCCAAAAGACTAAGGAAATCTTCAATAAG
CCAAAGTACATGAAGTAAATACTTGACGACATCAAGGAAGCTTGTAATGTTCTTAAAGAG
TTCCAATCACTATTGGGCAATGATCTTAAAGCTGTTACTGGAAGCAGCGAGCAAATTGAT
GTTGTTACTGACAAAGTCAAAGAATGCGTAAGTAAACTAGAAGGTTTCCCCAATGACGTC
TTCAATTCTGACTACGATGAGCAATGGAAGATGATTTTCGAAGGATTCAAGCACTCCATC
GCTCAAATCGAAGATGAGACTTCAACCCTTATCAACACCACTTTCAAGGATAAGTTGAAC
TCAGCCGAGGGTGCATTTGATCTCCTCCACAAGTTCAAGAATATCGTCACTAGACCAAGA
ATTGAAGAGCAAATGAGGAATAAGTACACTGATGTACTGACCAGATACGGCTAAGAAGTC
GGTGAGATGGAGAAACTCTATCTCAAGGGCAAGGACAACCCACCTATTTCCAAGAACATG
CCACCTAAAGCAGGAGCTATTGCTTGGGCTAGAAGTATTATGGGTCGTATAAAGACACCT
ATCTACAAGTTCAAAACCAAGGATGGCTTGTTGCAGCAACCAGTCGGTGTTCAAGTAACA
AGACAATATATCAACCTCGCTAAGCAACTCGACGCAGAGTATGAAATGAAGATATTCCAA
GATTGGAACAAAGAAAACACTGACTTGGCTATTAAGCTACTTAAAAACTTCATTCTTTCC
CAGAAGTAGGATCCTGAGACTAAGCAGATGCAATACTATGTTAACTTTGCACCTGAACTC
AAAGTCATTATCAGAGAGGCCAAATTCTTGGATAGAATCGGCAAGGAAATACCTCAAACT
ATTATCAATATTGCCTTATAAGAGAAAGACTACATGAGACACATTGATAAGTTAAATCAA
CTCCTGAGAGGCTATAACTCAGCTTTAAGCAACTTAAAGCCCGTTGAAAAGAAACTTCTT
GAAAAGCAAATCTCCAAGTTGAACAGATGGATGGATAAAGGTGCCTTAAACCACAATTGG
TTCTCTCTTTCAATTGCAGAGTACATCAGAGAATGTCAAAAAGCGATTGATGAGTTTAAA
GAAACCAAGAGCAGAGTTTTGCAACATGCTCAAAACATTGAGAAAAAAGTGCTCACCATT
GAAAATGCTGTCATTGTAAGAGAAATCGATTTCGATAGAAAGACTCCTATGGATATTTCG
GAGTTTTCTGAATTCTTTGAGTCTCACAGACAAAAAATTCTGGGGGAGCTGGTCAAGGAC
TATCAAAACATTGGTGATATGTATTTGAAGAGTATTGAAGAGTGCACAGTTAAGACTAAC
AATCAAGGTGCTGAGGAGATGAGACCCTACTATTACTATTGGGAAAGAAGAATCTTCAAT
GCAATCACAAAGATGGTCATAAGAGCACTCGCTGCCAATAAAACTCTCTGGATAAGAACT
GATAAACCATCACTCATTAAGATGATGTCTTCTTACAATCATCCAGAAATGACCTATCAC
CCAACAGTGGATGAACTCAGAAATTAACTTGAAAAGTTCACCAGAGGAATTTTAGAATCC
ACTAAATAATTCGGAAGATGGTGGGATGGATTCTGCAAAATTTTCGAGGAGAGAATTCAT
GATGAGACCTCTGAAAAGTACATTCCTTATACTTTTTATGACGATGTGATGTTGAACCCA
GTAATCACTCACTTGCATTATGAGATTTGCCAAGCCAGAAACCAAGTTATCGATAAGTTC
CAACTGTTCTCAAAGGGTTGGATTAAGAAAATGAATGTGAAGAGTCTTTTCGATAAAAAT
GAACTCACTAAGTTCCAGAAGTTGCTCTTCAAGAACTAACAGACAAGTGAAATCGAGAAG
CACATTTAAAACTTCAAAGCATACAAGAGAGAAATGAAAAAGATTCCTGATGAAGCCAGA
AATTACTTTGTGTTGGTTGATCATTCAGAAGTGAAGTCAGCTACAATTGAAAAAGTAGGT
GAATGGCTCACACTTTTAGGAGAAGCTCTCACAGATATGGCTACAAGAGAACTCGGTTCA
ATCATTAAAGATATCAATGAATACGAAAAGCAATTGAAGGCTGAAATGGGAGGTCTAGAT
AGTTTGAAACATTTGCTTAATGTGATCAGTGAAATTAAGAACAAATCAATGGATATGGAA
TTCAGAATTAATGAAGTGCAAGAACAATTCAGAATTCTGAAGATGTACAAGTACGATGTT
AATCCAGATATATAAATCTAAGTTGACTCAGTTGCATCAAACTGGAACGAACTTCTTGAA
ATGGCAGATCGTAAAGATTTTGAGGTCATTGACTTCAAGAAGAATTTCGCTCAAGTAACT
CAAGGTGATGTACTAAAGTTCAAGAATGAACTCAAGGAAGAGTATGAAAAGTACATTAGC
AATGGTCCAGGAGCTGACCACGTCACACTTGAAGATGGTGTGGAACTTCTCTAATTGAGC
AAAGATTAAAACCGCAGATTCAACAGACGCAGAGAAGAGTATGTCCTGGCTGAAAAATTA
TTTAACTTGCCAATCTCAAAGTTCCCAGAGCTCATTAAGATGGAAGAAGACAACAAAGTT
TTCGACGAAATTTATTCAATCTTTAAGGAGCACTAGTAAGGTGTCAAGGAATGGAGTATG
ATGCCCTGGTCCAAATTGGATGTACAAGTATTAGTCAGCGGAGCTGAGAAGTTTGAGAAA
CTAGTCAGAAAATTACAGAACAAAATTCCAAATGCTGAGAGCATTTCTCCCTTTGTTAAA
CTCAAAACAACTATTACTGGATTCAAAGATTCATTGCCACTTATTCAGCAACTTAAAATT
CCTGCTGTCTAAGAACGTCATTGGAATAAGATTATGTAGGAGACTGGTAAAGATCTTGGA
GAAATTAACCTTAAGACCATCACACTATCAAAAGTGTTTGAATTGGAACTTTAATACTAT
ACAGAGAAAGTCGTAGAAATTTGTCAAGAAGCCAAGGAGGAAGCTAAGAACGAAGAAAAC
CTGTAAAAGATTGAAACAGCTTGGAAAGTTTAAAACTTCGATATCCTTGCTTATAAGAAG
GGAACTGAGCTTAAAGGCTACGCCATTAAATCCCCAGACGATATTAGATAACTACTAGAA
GATAACATTTTGATCTTGTAGAGTTTGAATGCGAGTAAATATGTGAGGGCGATTAAAGCC
AAGGTTTCGCAGTGGGAGCGAGATCTCAATACTATCAACGATGTCATCGATGCTTGGCTT
ATCGTTTAGCGTAAATGGATGTATCTAGAGAGCATCTTCGCAAGTGACGATATCAGAATG
CAACTGCCAGATGAAGCCAAGAAATTTAACAAAACAGACAACAATTATAAGAAAATCATG
GAAGCTGCCTTTAAAAACTCAAATGTAATCTAATGCTGTGTTAGAGCTGAAGGCGGTAAT
AGACTGAGTGAATTGAAAAACATCTCAGCTGAGCTTGATAAGTGTCAAAAGTCACTTACT
AACTATCTTGAATCCAAGAAGATGAGTTTCCCAAGATTCTATTTCATTTCTGATGACGAT
CTGTTGCTGATTCTTGGTTCCTCAGACCCCAGATCTATCTCTCCACATTTACTCAAATTG
TTCGATAATTGCAAGGATGTTATCTTTGGCAAGGGAGATAAGCAAATCATTGGTATGATT
TCAGATGAAGGAGAGAAATTTGACTTTGAAACTCCTCAAAAACCAGAGGGAAATGTAGAA
GACTGGATGAACAAAGTAGACGTAGAAATGAAAAAGACTTTACACGTAATCACTAAGAAA
GCTGCTTTCTACTATGCAAAGCAAGATCGTATGGATTGGATTAAAGAGCAAATTGGTATG
GTTGCCCTTGTTGGTACCCAGATTTGGTGGACCTTCTAAGTAGAGGATGTGTTCAGAAGA
GTGAAAGAAGGTGACAAACACGCCATGAAACAAGAGCTTTCTAAAGAGACATCAGATCTA
AACGATCTAATTGCTTTGATCAGAACAGATCTAGACATACTAATCCGTAAAAGTGTAAAC
ACACTTATTATCTTGGATGTGCATGCCAGAGATATCGTAGAGAGATTCGTCAGAGACTCC
ATCTTAGATGCTAAAGAGTTTGAGTGGGAGTCACAACTAAGATTCTACTGGGACAAGAGA
AAGGATGATCTAGCCATCAAACAATGTACAGGTACCTTCGATTATTGCTATGAATATCAA
GGACTTAACGGAAGATTGGTTATTACACCACTTACTGACAGATGTGTTATGACATTGACT
ACTGCACTTACTTTCAAGTTAGGAGGTGCTCCAGCTGGTCCCGCTGGTACAGGAAAAACT
GAGACAGTTAAGGATCTAGCTAAATCACTCGCTCTTCGTTGTGTTGTAACAAATTGTGGA
GAAAATTTAGATTACTTCGCTATGTACATCATTTTCTCAGGTCTCATTCAAACTGGTTTT
TGGGGTTGCTTCGATGAGTTCAATCGTATTAACACTGAGGTACTCTCTGTCGTTTCAGCT
CAGATTAAACTTATTCAAAACGGTTTAGCCCAAGAAAAGAAGAAAATTGATTTCTAAGGT
ACTGACATGAGACTTATTCATACAGTTGGTATTTTTGTAACCATGAATCCAGGATATGCA
GGTCGTTCAGAGCTCCCAGATAACCTCAAAGCTATGTTCAGACCAGTTACTATGGTCGTC
CCTGATCTCATTCTTATTTGCGAGAACATGCTCATGTCTGAAGGTTTCAATTCAGCCAAG
ATTCTTGCCAAAAAGATGACAGTACTTTATAAGCTTTCTAAAGAGCAACTTTCAAAGCAA
TATCATTATGATTTCGGTCTAAGAGCCTTGAAGTCAGTGCTAGTCATGGCTGGTTAATTG
AAGAGAGCTTATGCTGATTTGCACGAGGATATTGTGCTTATGAGAGCTTTGAGAGATATG
AATATGCCAAAGTTCGTATTTGATGATGTGCCTCTTTTCACTGGTTTGATTAATGATCTA
TTCCCCGGACTAAAAGCAGATCGTGTTGGATATGAAGACCTCAAAGAGAAGATTGTAGAG
GATCTTGAGTCAAAGAAGTACAGACATTCAGATGAGGAAATTTTCATGGATCAAGTAAAC
AAAATCATCCAATTGTACGAGACTATGGGAACTCGTCACACTACTATGGTCGTAGGACCT
ACAGGTTCAGGTAAGAGTGTTATTATCAACACTCTCGCTTCTTCACTTAAAGAAGAAAGT
GGTATTCCAACCAAGATCGATACTATCAACCCTAAGATGTGTACCCTTAATGAGCTTTAT
GGAGTCTTAGATCCAGATAGTAGAGATTGGACAGATGGTCTCCTTTCCAAAACATTCAAG
GATGCTAACACTGAAATTCCAGGACGTACTGAAAGACGTTGGATTATATATGATGGTGAT
GTCGATGCCGTTTGGGTTGAAAACATGAACTCCGTCATGGACGATAATAAAATTCTTACA
CTTGCTAATGGTGATCGTATTCGTTTACTCAGAACCTGCGCTATGCTTTTCGAAGTTTAT
GATTTGCAATATGCCTCACCTGCTACAATTTCCAGATGCGGTATGGTCTATGTCGATCCC
AAGAATCTAGGTTATGCTCCCTTCTTCGAGAGATGGTGCAAAGATAAGCTCGAGAAATAC
TCTGAAGTCATGTACGAAAGTTTGAGAGAGCTCTATGCCAAGTATGTTCCAGTATGCATT
GACAGAATCTTCGAAGGTTCAACAGGCAGCGATGAAATAGTAGAGCCCCTGAAATTCATT
ACTCCAAGAACTAACTTGAACTTAGTGCAATAATTAGCCACATTAATTGACTCAATCATC
CCACAACCAGACCAGAACCCTCCTCAAGAAGTAGATCAACTTGAAAGACTTTTCATTTTC
TGTCTTGTGTGGTCTCTTGGAGGTGCACTTATATCTGATGATAGAGAAAAGTTCTCTGAG
TTTATTAGAACTACGAGTGGACTCATCTTACCATCAAGCTCCCTATATGATAACTACTTT
GATATTGAAAGCATGAGTTATGTACTCTGGGAAAGAAAGGTAGCTGAATACGAAGCTCCA
GCAAACAAAAAGTTCTCATCTATTCTCGTACCCACCGTTGACACCAAAAGATACTCATGG
CTTCTTAGTCAAATTATGTCTCTCAAAAAGCCTGCTATGTTCGTTGGAGACTCTGGTACT
GCCAAGACTGTCACCATATTCTCTCACTTCAAGTAACTTAGTATGGAGAGATTCACTATC
TTGAATATCAACTTCTCTTCACGTACCACATCTATGGACTTCCAGAAGAACGTAGAGGAA
AATATTGATAAGAGATCATTCAAGCAATATGGTCCAAAGACTGCAGGAAAGCAATTGATT
ATCTTCATTGATGACTTGAACATGCCAAGAATTGATAAATATGGTACCCAATAACCAGTT
GCCCTCATGAAGTTCTTGATTGAAAGAAACCAGCTCTATCAAAGAGGCGGTGAGCTCGAA
CTCAGAGAAATAGTAGACACACAATATGTTGGAGCTATGACTCCACCAGGTGGTGGTAAC
AACCCAGTCGACCCCCGTGTAATGTCTCTCTTCTCAACCTTTAACATTACTTTCCCATCG
AAAGAAGCTATCGAGAAGATTTATACTTCCATCCTTGAGAAGTAATTGGTTGAATTCCAT
GAAGACATCAGAAACGTAGTGCCTAAAATCACCTCTGCTACACTTTCACTTTATTTCTAA
ATCTGCGAGAAACTTCCTCGTACTCCAGTGAAGTTCCATTATATTTTCAACTTGAGAGAT
CTCTCAAGAGTTTATGAAGGTCTCTGCATGATGACCATTGACAAGTTCTAAACTAAGGAG
AGCTTGGTAAGAGTATGGAGAAATGAATGCATGCGTGTGTTCTCAGATAGACTTGTTAAT
GAGACAGATCGTAGTTTAGTCAGCGATTAACTCATCGGAAGTCTGGTAAAAGAATTCTTC
CCAGGTACTGAAGAATACGTAATGAGAAATCCTTGCTTATTCGGGGATTACGCACTCTCA
GACCCCACTGATGAAGAGGCTGAAGATCCCAGACTATATGAAGATTTAGGAGAGTATGAT
GACGTTAAGAAGAAGATGAACAAACTCCTTGAAGACTATGGATTCGAAAACAAACCCATG
AATTTAGTGTTGTTCAATGATGCACTTGAGCATGTTACAAAGATTCACAGAATCATCAGA
TTCCCTAAGGGTAGTGGCCTGTTAGTCGGAGTTGGTGGTTCAGGTAAGCAGTCACTGACC
AGACTTGCTACTTTTACTGCAAACTATGATCTTTTCACAATTGGACTTGTTAGAAATTAC
AAAGAGGAGAACTTCCGTGAAGACTTAAGAGTCTTGTATAGAGAAGTCCTTAAAAAGCCC
AAAACTTTCTTATTCACAGATGCCCATGTGGTTGAAGAAGGTTTCTTGGAATTGATCAAT
AACATTCTTACAATCGGTATGGTTCCAGCCCTTTTCCCAGAAGAAGAGAAGGATGGTCTC
ACCTTCCCATTAGATGAAGAAATGAGAAAGCAAGGTCTCCCAGACACTAAGGAATTCAGA
TGGCAATACTATGTCAACAGAGCAAGAGAGAATCTTCACATTATTCTTGCAATGTCTCCT
GCCGGTGACACTCTCCGTCTCAGATGTAGAAACTTCCCAGGTCTAGTCTCAAACACAAAT
ATTGATTGGTTCTTCGCTTGGCCTGAAGATGCCTTAGCTGCTGTCGCCTCTTACTTCTTG
GTAAACGTCGAGCTGGAAGACGACCACAGACAACCAGTTACAGATCACATTGTGATGATC
CATCAATCAGTACAACAGTATTCAGTAGAGTTCGAAGCAATTTATAAGCGCAAAAACTAT
TCTACTCCCAAGAACTATTTAGATTTCATTGACAATTACATAAAATACTTAACCAACAAT
AGAAAAACGATTGACTCAAATGTGAGAAGACTTGAGGGTGGTCTCACTACTCTAGCTAAA
GCTCAAGAAGACACTGAAGTCTTATCCAAGGAATTGGCTATCAAGAATGCTGAAATTGCA
GAAAAGAAAAAGGTTGTCGAGGAGCTTATCGCAGATATCACTGAGAAATCAGAAATTGCT
GGGAAACAACAAGCTATTGCAGTAGAAAAGAAGACATTTTTGGATTAACAGAGTGTCATT
ATTGCCAAAGAAGAGGAGGAAGCTAGAATTGCTCTAGATGAAGCTCTCCCCGCTCTTGAA
GCTGCATCACAAGCACTTAACAACATTAAACCATCTCATATTACTGAAATCAAGTCCCTT
CCTCAGCCACCTTAAATCATTCAAGATGTGTGCACCATTTGTTACTTCTTGTATCCAAAG
GGAGGTGCAGATGATCAATGGGCCTCAGTTAAGCTTAAATTGCTCGGAGATATGCAGCTT
TTGACAAACCTCAAAGAATATGATGTCTCTAAGACCAAGAGTGATCAAGCAAGCAGAGCT
AAGAGGAAACTCACTCAACTCGAGAAAGATTGCGGCTGCACAGGTATCGAGCTACAGCAA
CTTATTATCTCTAAGAATATGGCTACAGGTGGTCTTTTCCAATGGGTTATCGCCACTGTT
AAGTGTTATGATATCTATAAGGATGTCGAGCCTAAGAGAAAGAAGGCTGAATAAATGAGA
CAGGCAAAAGCCCAAGGAGAAAGAGAACTTGCTGAGACAGAAGCCAGATTGAAGGAAGTC
ACAGAAAAGTTGAATATTTTGAACGCAAACAAAGCTGTGAAGCAAGCAGAGTTGGATGAC
CTAGAAGCTAAGTCACGTGAGATGTAGAGAAAACTCGATGCTGCATCCAAACTTATTACT
GGCTTAGGCTCAGAACAAAAACGTTGGACTATTGATTTGGAAAGCTTGGGTACCGATAAG
ATTAAGTTAGTAGGAGACTGCTTGTCTGGTAGTGCTTTCTTGAGTTACTGCGGTGCTTTC
AATTTTGATCTTAGAAAGAAAATGGTCTATGATCACTGGAAATTAGATTTGATTGCTAAG
AACATTCCAAACAAAGAAGGCTACAGGTTAGAGAAATTCTTGACAAACGATGTCGAAATA
TCAAAATGGGCCTCCGAGGGTCTTCCTTCTGATGAGCTTTCAATTTAAAATGGTATCTTG
ACAAAGAATGCAAGCAGATTCCCTCTTTGCGTTGACCCACAAATGCAAGCTGTGTTCTGG
ATCAAAGAAAAAGAAAAGAAATCAAACTTGGATGTGCTTTCTTTCAATTAAGCTGATTAT
ATTAAAAGACTTGAAATGGCTATCACATTTGGTAAGCCAGTACTATTCGAAGCTATCGAT
GAAGAAATCGATCCCATGATTGATCCAATTCTTGAAAAGAATATCATCGTATAAGCCGGT
GTTAAAATGATCAAACTAGGAGATCAGAATATTGAATATCACGATGAATTCCGTCTCTAC
ATGACCACCAAGATTGCTAATCCTAACTACCCTCCAGAAACCTACGGTAAAACTATGATC
ATTAACTTCAATGTCACATTGTAAGGTCTAAGAGATCAACTTTTGAATGAGGTTGTAAGT
TACGAACGTCCAGAATTGGAGAAGCAACGTAAATAACTCGTTATAGAGACCTCTCAAAAC
AGATCTACATTGAAAGATCTAGAAGACACACTTCTCAGTGAGTTGAGTAAAGAGACAGAC
ATTCCACTTGTGGATAACGTTCCACTTATAGAAGTTCTCGAAAATGCAAAGAGCAAGTCT
GTTGAAATCGCATCTGCCCTTGAAACCGCCAAAATTACCGAAGCTGATATTGAGCAAAGT
AGAGAATCATATAAGGATGTAGCTAAGAGAGGTGCTATTCTGTTCTTCGCAATGCAAGGA
CTCTCAGCTATTTCTGAAATGTACGAGTACTCACTATCCAGTTACTTAACTGTATTCAAG
AATGCTCTTGAAAGCGCAAGAAAAGATAATATTCTCTAGAATAGACTAAGAAACATTAAA
GAAAAACTTACTCAACTTGTCTATGAATTCACATGCATGGGTATCTTTGAAAGACATAAG
CTCATGTTCTCTTTCCAAATGACAACAATGATCATGGATGGTGACAACGAATTGAACAAA
TTAGAGCTTGATTTCTTCCTCAAGGGAAACACCAGTTTAGATGCCATCGCAAGATCAAAG
CCTTACGTTTGGCTCTCAGCTAACGGCTGGAAAGATCTCCAAAGACTTCAAACCCTTGGT
GATGTTTGGAAGACAGTTATCGATGACTTAGAAAATCATGGAAAATAATGGGAGACTTGG
TATGATCTAGAAGCACCAGAGTAGGTTGAGATTCCTTGCGGATACTCCGAAAAACTTAAC
AAATTCCAACAGCTTTTGATTGTGAGATGCTTTAGACCAGATAGAGTCGTAAACTCCATT
AAGAACTTCATCATAGAAAAAATGCACGAGCAGTACGTTAAGTCACCACCTATCAGGTAC
GACAGAATTTATGAGCAGTCAACTGAGAAAACCCCAATTGTCTTTATTCTTAGTCCAGGT
GCTGATCCCTTCAGTGATGTGTAAAAGTTAGCTGAGCAAATGGGCATGGGCGGTAAGTTT
AAGTTCTGCTCCCTTGGTCAAGGTCAAGGAGAAACTGCCAAGCAACTTATTGAGAGTGGA
GCTATGAGAGGTCAATGGGTTATGCTTCAAAATTGTCACTTGCTCGTTTCATGGTTGAAG
AAACTTGAAACAATTATTGAAAATATCACTAAACCAGATAAGAACTTCAGACTTTGGTTA
ACTACTGCTCCAACTGACAGATTCCCTCTTGGTATCCTTCAAAAATCACTTAAAGTCGTT
ACTGAGCCACCCGATGGTCTCGGTCAAAACATCAAACAAAGCTACTCCAAGCTTACGGAT
GAAATGTTAGTAGAGTGCCCCACTAAAGAATTCAAATCTCTCGTTTACGTGCTTGCTTTC
TTCCACGCAGTCATTTAAGAGAGAAAGAAATTCGGTAAAATTGGTTGGAATGTCACATAT
GACTTTAACGATAGTGACTTTAAGATCTCATTCAGATTGATTTCTATGTACTTGAACAAA
GCCTTCTAAAATAATGAAGAAGAATTACCATGGGAAACACTGCGTTATCTCATCGGTGAG
GCTATGTATGGTGGTAGAGTCACAGATGACTTTGATAGACGTGTATTGAACACTTATTTG
AAGGAATACGTTGGAGATTTCATCTTTGACAACAACCAAACTTATTACTTCTCTCAATCA
GGCTACGATTACACCATTCCACAATGTGAGAATCTAGAGCTCTATATCAACTACATAGAC
TCGATTCCATTGTTCACATCACCAGGTGTGTTCGGTCTACATCCAAACGCTGAAATATCT
TATTTCACTAATACTGCTAAAGAAATCTGGTTGAACTGCATTGAAATGCAAACATCTGAT
GTGTCAGCCGGCGGTGGTATAAACAAAGAAGAGTATATCGAGCAAGTTGCCTCAGACATT
TAATCGAAACTACCAGAGCTTTTCGATTACTACAATATCAAGAAGAACATTGAAATCCCC
ACACCCGCTCAAGTTGTGCTATTACAGGAATTAGAACGTTTCAATAGACTTTTGGAGAAA
ATGCACAGTTCTATTTTTGATTTGAAGAGAGCACTGTTGGGAGAAATCGGTATGAGTATG
GAATTGGATGACTTGGCTAATTCATTGTTTAATGGTTTCTTACCATCTATGTGGTCAGCA
CTTGCCCCATAAACCCTTAAGAGCTTAGTCAATTGGATTGAGCACTTCATGCGCAGATAC
AACTAGTACAAGACTTGGATTGAAGTTGAGGAACCCAAGGCTATATGGCTCTCAGGTCTA
CACATTCCAGAATCTTACTTAACAGCCTTGGTGCAAACCACCTGTAGAAGAAAGGGATGG
GCGCTTGATAAGAGTACTCTTTACACAATCGTCACCAAGATTAAGAATCCAAATGAAGTA
AAGAAGAGACTTGAAGATGGTTGTTACATCTAGGGATTGTATTTAGAAGGTGCCATCTGG
CATAGCGAAAAGGACTGCCTTGACTACCAGAACCCCAAGGAACTTATTGTTGAAATGCCA
CTCATTCAAATTATTCCAATTGAAGCTAACAAACTCAAGCTTAGAGGCACCATTAGAACT
CCCGTATATGTCACACAAAACAGAAGAAACGCCATGGGAGTGGGTCTAGTGTTTGAAGCC
GATCTTAAGACAGACAAGCATCCCAGTCATTGGGTCCTCCAAGGAGTCTGCTTGGTCCTA
AACACTGATTGA


>Contig19661.0.g109(protein)
MDEDETYQRLTGLSSMIQQVYLPLMESRTETRLQMEKFVRQISISLQQAYGNVTIKVPYV
PQGVSDEEICRNRSLIEEYQNTIEEWANTIKETIDREKDRQKEMNTAYGEVEYWRSRSAT
FNTLYQQLTMPQVRKIIQIMVANETLNQDAFSLEHFNSQWANFSKLHAQAKDFVKFLTTL
ERQFKIITRGELNVIEETLPSLLNGLKLIWTISRHINQNDSKMEDLLESISNEICEKVRA
QIDIRRIFKINPAVAINTITQGISVLEKWQQQFIKTKMEIESESTVKRWDFQKTKEIFNK
PKYMKQILDDIKEACNVLKEFQSLLGNDLKAVTGSSEQIDVVTDKVKECVSKLEGFPNDV
FNSDYDEQWKMIFEGFKHSIAQIEDETSTLINTTFKDKLNSAEGAFDLLHKFKNIVTRPR
IEEQMRNKYTDVLTRYGQEVGEMEKLYLKGKDNPPISKNMPPKAGAIAWARSIMGRIKTP
IYKFKTKDGLLQQPVGVQVTRQYINLAKQLDAEYEMKIFQDWNKENTDLAIKLLKNFILS
QKQDPETKQMQYYVNFAPELKVIIREAKFLDRIGKEIPQTIINIALQEKDYMRHIDKLNQ
LLRGYNSALSNLKPVEKKLLEKQISKLNRWMDKGALNHNWFSLSIAEYIRECQKAIDEFK
ETKSRVLQHAQNIEKKVLTIENAVIVREIDFDRKTPMDISEFSEFFESHRQKILGELVKD
YQNIGDMYLKSIEECTVKTNNQGAEEMRPYYYYWERRIFNAITKMVIRALAANKTLWIRT
DKPSLIKMMSSYNHPEMTYHPTVDELRNQLEKFTRGILESTKQFGRWWDGFCKIFEERIH
DETSEKYIPYTFYDDVMLNPVITHLHYEICQARNQVIDKFQLFSKGWIKKMNVKSLFDKN
ELTKFQKLLFKNQQTSEIEKHIQNFKAYKREMKKIPDEARNYFVLVDHSEVKSATIEKVG
EWLTLLGEALTDMATRELGSIIKDINEYEKQLKAEMGGLDSLKHLLNVISEIKNKSMDME
FRINEVQEQFRILKMYKYDVNPDIQIQVDSVASNWNELLEMADRKDFEVIDFKKNFAQVT
QGDVLKFKNELKEEYEKYISNGPGADHVTLEDGVELLQLSKDQNRRFNRRREEYVLAEKL
FNLPISKFPELIKMEEDNKVFDEIYSIFKEHQQGVKEWSMMPWSKLDVQVLVSGAEKFEK
LVRKLQNKIPNAESISPFVKLKTTITGFKDSLPLIQQLKIPAVQERHWNKIMQETGKDLG
EINLKTITLSKVFELELQYYTEKVVEICQEAKEEAKNEENLQKIETAWKVQNFDILAYKK
GTELKGYAIKSPDDIRQLLEDNILILQSLNASKYVRAIKAKVSQWERDLNTINDVIDAWL
IVQRKWMYLESIFASDDIRMQLPDEAKKFNKTDNNYKKIMEAAFKNSNVIQCCVRAEGGN
RLSELKNISAELDKCQKSLTNYLESKKMSFPRFYFISDDDLLLILGSSDPRSISPHLLKL
FDNCKDVIFGKGDKQIIGMISDEGEKFDFETPQKPEGNVEDWMNKVDVEMKKTLHVITKK
AAFYYAKQDRMDWIKEQIGMVALVGTQIWWTFQVEDVFRRVKEGDKHAMKQELSKETSDL
NDLIALIRTDLDILIRKSVNTLIILDVHARDIVERFVRDSILDAKEFEWESQLRFYWDKR
KDDLAIKQCTGTFDYCYEYQGLNGRLVITPLTDRCVMTLTTALTFKLGGAPAGPAGTGKT
ETVKDLAKSLALRCVVTNCGENLDYFAMYIIFSGLIQTGFWGCFDEFNRINTEVLSVVSA
QIKLIQNGLAQEKKKIDFQGTDMRLIHTVGIFVTMNPGYAGRSELPDNLKAMFRPVTMVV
PDLILICENMLMSEGFNSAKILAKKMTVLYKLSKEQLSKQYHYDFGLRALKSVLVMAGQL
KRAYADLHEDIVLMRALRDMNMPKFVFDDVPLFTGLINDLFPGLKADRVGYEDLKEKIVE
DLESKKYRHSDEEIFMDQVNKIIQLYETMGTRHTTMVVGPTGSGKSVIINTLASSLKEES
GIPTKIDTINPKMCTLNELYGVLDPDSRDWTDGLLSKTFKDANTEIPGRTERRWIIYDGD
VDAVWVENMNSVMDDNKILTLANGDRIRLLRTCAMLFEVYDLQYASPATISRCGMVYVDP
KNLGYAPFFERWCKDKLEKYSEVMYESLRELYAKYVPVCIDRIFEGSTGSDEIVEPLKFI
TPRTNLNLVQQLATLIDSIIPQPDQNPPQEVDQLERLFIFCLVWSLGGALISDDREKFSE
FIRTTSGLILPSSSLYDNYFDIESMSYVLWERKVAEYEAPANKKFSSILVPTVDTKRYSW
LLSQIMSLKKPAMFVGDSGTAKTVTIFSHFKQLSMERFTILNINFSSRTTSMDFQKNVEE
NIDKRSFKQYGPKTAGKQLIIFIDDLNMPRIDKYGTQQPVALMKFLIERNQLYQRGGELE
LREIVDTQYVGAMTPPGGGNNPVDPRVMSLFSTFNITFPSKEAIEKIYTSILEKQLVEFH
EDIRNVVPKITSATLSLYFQICEKLPRTPVKFHYIFNLRDLSRVYEGLCMMTIDKFQTKE
SLVRVWRNECMRVFSDRLVNETDRSLVSDQLIGSLVKEFFPGTEEYVMRNPCLFGDYALS
DPTDEEAEDPRLYEDLGEYDDVKKKMNKLLEDYGFENKPMNLVLFNDALEHVTKIHRIIR
FPKGSGLLVGVGGSGKQSLTRLATFTANYDLFTIGLVRNYKEENFREDLRVLYREVLKKP
KTFLFTDAHVVEEGFLELINNILTIGMVPALFPEEEKDGLTFPLDEEMRKQGLPDTKEFR
WQYYVNRARENLHIILAMSPAGDTLRLRCRNFPGLVSNTNIDWFFAWPEDALAAVASYFL
VNVELEDDHRQPVTDHIVMIHQSVQQYSVEFEAIYKRKNYSTPKNYLDFIDNYIKYLTNN
RKTIDSNVRRLEGGLTTLAKAQEDTEVLSKELAIKNAEIAEKKKVVEELIADITEKSEIA
GKQQAIAVEKKTFLDQQSVIIAKEEEEARIALDEALPALEAASQALNNIKPSHITEIKSL
PQPPQIIQDVCTICYFLYPKGGADDQWASVKLKLLGDMQLLTNLKEYDVSKTKSDQASRA
KRKLTQLEKDCGCTGIELQQLIISKNMATGGLFQWVIATVKCYDIYKDVEPKRKKAEQMR
QAKAQGERELAETEARLKEVTEKLNILNANKAVKQAELDDLEAKSREMQRKLDAASKLIT
GLGSEQKRWTIDLESLGTDKIKLVGDCLSGSAFLSYCGAFNFDLRKKMVYDHWKLDLIAK
NIPNKEGYRLEKFLTNDVEISKWASEGLPSDELSIQNGILTKNASRFPLCVDPQMQAVFW
IKEKEKKSNLDVLSFNQADYIKRLEMAITFGKPVLFEAIDEEIDPMIDPILEKNIIVQAG
VKMIKLGDQNIEYHDEFRLYMTTKIANPNYPPETYGKTMIINFNVTLQGLRDQLLNEVVS
YERPELEKQRKQLVIETSQNRSTLKDLEDTLLSELSKETDIPLVDNVPLIEVLENAKSKS
VEIASALETAKITEADIEQSRESYKDVAKRGAILFFAMQGLSAISEMYEYSLSSYLTVFK
NALESARKDNILQNRLRNIKEKLTQLVYEFTCMGIFERHKLMFSFQMTTMIMDGDNELNK
LELDFFLKGNTSLDAIARSKPYVWLSANGWKDLQRLQTLGDVWKTVIDDLENHGKQWETW
YDLEAPEQVEIPCGYSEKLNKFQQLLIVRCFRPDRVVNSIKNFIIEKMHEQYVKSPPIRY
DRIYEQSTEKTPIVFILSPGADPFSDVQKLAEQMGMGGKFKFCSLGQGQGETAKQLIESG
AMRGQWVMLQNCHLLVSWLKKLETIIENITKPDKNFRLWLTTAPTDRFPLGILQKSLKVV
TEPPDGLGQNIKQSYSKLTDEMLVECPTKEFKSLVYVLAFFHAVIQERKKFGKIGWNVTY
DFNDSDFKISFRLISMYLNKAFQNNEEELPWETLRYLIGEAMYGGRVTDDFDRRVLNTYL
KEYVGDFIFDNNQTYYFSQSGYDYTIPQCENLELYINYIDSIPLFTSPGVFGLHPNAEIS
YFTNTAKEIWLNCIEMQTSDVSAGGGINKEEYIEQVASDIQSKLPELFDYYNIKKNIEIP
TPAQVVLLQELERFNRLLEKMHSSIFDLKRALLGEIGMSMELDDLANSLFNGFLPSMWSA
LAPQTLKSLVNWIEHFMRRYNQYKTWIEVEEPKAIWLSGLHIPESYLTALVQTTCRRKGW
ALDKSTLYTIVTKIKNPNEVKKRLEDGCYIQGLYLEGAIWHSEKDCLDYQNPKELIVEMP
LIQIIPIEANKLKLRGTIRTPVYVTQNRRNAMGVGLVFEADLKTDKHPSHWVLQGVCLVL
NTD