Identifiers and Description

Gene Model Identifier

Contig19618.0.g4

Standard Name

None

Aliases

Contig19618_0_g4

Description

Endonuclease/Exonuclease/phosphatase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03372 ) Endonuclease/Exonuclease/phosphatase family
  • ( pfam08120 ) Tamulustoxin family
  • ( pfam03937 ) Flavinator of succinate dehydrogenase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005480302.0009381340492598e-66Endonuclease/Exonuclease/phosp
hatase family p...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19618.0.g4(coding)
ATGTTTGCGAATTTAGATTTAGAAACTCACAACAAAATTGTATTCAAAAAGCATCCACTA
CAAAGTGATGATGCATGTCCAGAACTTCCCAGAAAAAATTGCTTGAGATTGCTATCTTAC
AATATGTTTTTGCGGCCTTTTGTAAAAAATGTGGAAAACGATTGGAAAGATGAGAGGCTT
CATGCTTATGTGCAGTTATTGGACGATTTTGACATTATTTGCAACTAGGAAGTGTTTGAT
TTCTTCAATTATTCAAGGAAAGAGAGGTTAATATCGCATGCCATGAAAGCTGGCTTTATT
AACTATGCGGTAGCTCCACCAGCTCCATTTTTCTCAGAATATAGCTTAAGTGGAGGTCTA
GTTACTTTTAGCAGGTTCCCTATTCTAGAAACATCTTTCAAGCCATATCGCTATGGAGTA
TTATCTGATTAAATATCATACAAGGGTGTACTTTATTGCAAGATTGATGTTGCAGGTGCT
ATATTGCACATATTCCAGACCCACACATAGGCTAGTTATTTTGGAACAAGTGTAGAAGAA
TTCAATATTACATTTGAATGCAGACTTGAGTAGTTGAGAATAATTAGAATGTTTATTGAG
GAAAAGACTAGAAATGCGACATCAGATGAGCTTATAATATTATGCGGAGATATTAATGTT
AATGGAGCAAAGGTTGATAGAAAAGGTCAAGTTTATAGAGACATGGTCAAGGATAAACCT
GAATTTAAAGCAGTTCTTGACGAGTACGAGAGAGAATACGACCTATTAATTTCTATTTTG
ACGAATAATAATGAAGACGTGGCAGTTGATGTAATGAGGTAGGCTAATAGTGGAGTTTCA
CCAGTTACCTTTGGGGATTGCTACATAGACGAAAAAGGAAAAGAGCATCCATTAGAGACA
CAACTTGTGAAAGTAGAAGACCATTGCACTCAGCAATCTCTTGACTACATTTTTTAGATA
AAAAGAGGGTTTAACGTAGAGAAAGAACGCTTATAAATTGAGAACTAAAAAACAGCATCT
GGTACTCATAGCAACGAGCCTAAGTCTCAAAATGGAAAGTCTAAACATAAAAAGCTAGTT
GTAAGTATCGAAGAATCAAGAATTGAGAAATTCTTCTTTGATAGTCACCCAGTGATCAAA
TAGTGCAGTGATCACTATGGTGTATCAACTATTTTAAAATTAGTTTGA


>Contig19618.0.g4(protein)
MFANLDLETHNKIVFKKHPLQSDDACPELPRKNCLRLLSYNMFLRPFVKNVENDWKDERL
HAYVQLLDDFDIICNQEVFDFFNYSRKERLISHAMKAGFINYAVAPPAPFFSEYSLSGGL
VTFSRFPILETSFKPYRYGVLSDQISYKGVLYCKIDVAGAILHIFQTHTQASYFGTSVEE
FNITFECRLEQLRIIRMFIEEKTRNATSDELIILCGDINVNGAKVDRKGQVYRDMVKDKP
EFKAVLDEYEREYDLLISILTNNNEDVAVDVMRQANSGVSPVTFGDCYIDEKGKEHPLET
QLVKVEDHCTQQSLDYIFQIKRGFNVEKERLQIENQKTASGTHSNEPKSQNGKSKHKKLV
VSIEESRIEKFFFDSHPVIKQCSDHYGVSTILKLV