Identifiers and Description

Gene Model Identifier

Contig19588.0.1.g53

Standard Name

None

Aliases

Contig19588_0_1_g53

Description

Peptidase S24-like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010935605.001369568193564e-73signal peptidase I family prot
ein
SGDYIR022W1.9998323414791308e-36SEC11 SGDID:S000001461, Chr IX
from 398733-399236, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19588.0.1.g53(coding)
ATGAATATAATCACTGACACGTTGAATGAAATCAGATCTATGAAGTTCAGAAAGCTATTG
ATGCAAGGCCTGAGCTTTGGCATGATTGTATGCTCTGCTCTTATGATTTGGAAAACAGCC
ATGGTTTTCACAAACACTGAGAGTCCTGTGGTCGTAGTATTAAGTGGAAGCATGGAGCCA
TCGTATTACAGAGGAGACATCTTGTTTTTAACTAAAAAGGAAAATGTAGTAGTGGGAGAT
ATCATCGTGTTTTAACTCGATAATGAAGTTATACCCATCGTCCATCGTGTAATCACAATC
CAATAATTACCAAATAAAGAGATAAGAATATTGACTAAGGGCGATAACAATCCAGTTGAC
GATAGAGGTTTATACCCTAAGGGATAATTATGGATCAAAGAGCATTAAGTTATGGGTCAA
GTTGTTGGAAACGCACCGTATGTTGGCATGCTGACAATCTGGCTGAATGACTACCCTATG
TTGAAGTTTGCAGTAATAGGCCTTATGTTCTTGACAGTATTGGTATCGAAAGACCCATAG
TGA


>Contig19588.0.1.g53(protein)
MNIITDTLNEIRSMKFRKLLMQGLSFGMIVCSALMIWKTAMVFTNTESPVVVVLSGSMEP
SYYRGDILFLTKKENVVVGDIIVFQLDNEVIPIVHRVITIQQLPNKEIRILTKGDNNPVD
DRGLYPKGQLWIKEHQVMGQVVGNAPYVGMLTIWLNDYPMLKFAVIGLMFLTVLVSKDPQ