Identifiers and Description

Gene Model Identifier

Contig19465.0.g67

Standard Name

None

Aliases

Contig19465_0_g67

Description

Melibiase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • hydrolase activity, hydrolyzing O-glycosyl compounds (IEA) | GO:0004553

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000437709.998919090800975e-129alpha-galactosidase, putative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19465.0.g67(coding)
ATGAAATCTATTTCTATAGCAGTTTTCGCTTTGTTATACTCCTCAGTTTTCGGACTTGAG
AATGGCATTGCCTAAACCCCTCAGATGGGTTGGAACACTTGGAACAAATTCGATTGTGGA
ATCAATGAGACTTTAATCAAACAATCAGCTGACAAGATAATAGAACTTGGTCTTGATAAA
CTTGGCTACAAGTATGTTAACATCGACGACTGCTGGAACGCAGTGGAAAGAGATTCAGAG
GGACGCATGCAAGCTGATCCCAAGACTTTTCCTGGAGGTATGAAAGCAGTTGGTGATTAT
ATTCATTCAAAGGGCTTAAAGTATGGAATTTACTCTTCAGCTGGCAACTTTACTTGCTAA
GGTAGAGCTGGCAGTCTCAATCACGAAGATATTGATGCTTAAACCTGGGCTGATTGGGGA
GTTGACTACCTAAAGTATGATAACTGCTTCAATGAAAATGTTCCAGCTACAGTGAGATAC
CCAGCAATGAGAGATGCCTTACTTAAAACAGGCAGAAATATTTTCTATTCAATATGCAAC
TGGGGAAATGAAGAAACTTTCAAGTGGGGTCCAGACACTGGTAACAGCTGGAGAACTACC
ATGGATATCAAGGATATTTGGCCATCTATCTAGTATAATTACAGACAAAATGATGTTCAT
TACGATATCGCTCACCCAGGTGCATGGAATGATCCAGACATGCTTGAAATTGGAAATGGT
GGATTAAACTAAAATTAAGAAAGAACTCACTTCGCTCTTTGGGCTGTGGCTAAATCTCCA
CTTATTCTTGGATGTGATTTAGACAACATTCCTAAAGATAGTTTTGAGATTATCACCAAT
ACTGAACTTATTGCAATTAACCAAGATCCACTTGGCAAGCAGGCTCATTGCAGAGTTCAC
TGCTCATCCACAGATATTTTAGTCAATAGAGCTCAAGTATATGCTGGTCCTCTCGAAAAC
GGTGATATTGCAGTTGTGGTAGTCAACTGGGGCTTTTTAAGTCTTGGAGCTTTCACCCTA
AACTTTTCAGATATCGATTTATCAGCTACAACCTCAGCCACAATTAGAGACTTATGGGAA
CATAAGGATATTGGAGACTTCACAGGCACCTACTCAATTGATAAATTTGAGCCATATCAA
AGCTACGCTTTTAGAATCACACCCAAGAAGGCCTAAGAGTTCCTCAATTGA


>Contig19465.0.g67(protein)
MKSISIAVFALLYSSVFGLENGIAQTPQMGWNTWNKFDCGINETLIKQSADKIIELGLDK
LGYKYVNIDDCWNAVERDSEGRMQADPKTFPGGMKAVGDYIHSKGLKYGIYSSAGNFTCQ
GRAGSLNHEDIDAQTWADWGVDYLKYDNCFNENVPATVRYPAMRDALLKTGRNIFYSICN
WGNEETFKWGPDTGNSWRTTMDIKDIWPSIQYNYRQNDVHYDIAHPGAWNDPDMLEIGNG
GLNQNQERTHFALWAVAKSPLILGCDLDNIPKDSFEIITNTELIAINQDPLGKQAHCRVH
CSSTDILVNRAQVYAGPLENGDIAVVVVNWGFLSLGAFTLNFSDIDLSATTSATIRDLWE
HKDIGDFTGTYSIDKFEPYQSYAFRITPKKAQEFLN