Identifiers and Description

Gene Model Identifier

Contig194.1.g74

Standard Name

None

Aliases

Contig194_1_g74

Description

Protein kinase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00069 ) Protein kinase domain
  • ( pfam07714 ) Protein tyrosine kinase
  • ( pfam01636 ) Phosphotransferase enzyme family
  • ( pfam06124 ) Staphylococcal protein of unknown function (DUF960)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005372403.000805390066315e-169Protein kinase domain containi
ng protein
SGDYBL016W1.0003180480544985e-86FUS3 SGDID:S000000112, Chr II
from 192451-193512, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig194.1.g74(coding)
ATGACTGAAGAAATTGAAGCTCACGTACTAAAGAAGTACGAAATCTTACAAAAACTAGGT
AAGGGAGCTTATGGTATCGTTTGGAAGGCTATCGACAAGAAAACTAAGGATATTGTGGCA
TTAAAGAAAAATTTTGATGCTTTTCAAAATGCTACAGATGCATAGAGAACATTCAGAGAA
ATCATTTTCTTGCAGGAGCTTAACGGTCACGAAAATATCATTAGGTTGCAAAATGTCATT
AGAGCAGAGAATGACAGAGATATATATCTCGTTTTTGATTTTATGGATACTGATCTACAT
GCAGTCATAAGAGCAAATATTTTAGAGGATATTCATAAGCAGTATATCATGTATCAATGT
TTCAAGAGCTTAAAGTTCATGCACTCTGCGAATCTATTACATAGAGATCTTAAGCCTAGT
AACTTGCTGCTGAATTCTGAATGCCATGTTAAAGTAGGAGATTTTGGTCTTGCTCGTTCA
CTTGATGTTAGGGATCCAGATACCGTTCCACTGTTGACTGATTATGTTGCTACCAGATGG
TATCGTGCTCCAGAAATTTTGCTTGGCTCTAATAAATACACTAAGGGAGTAGATATGTGG
AGTATGGGTTGTATTTTGGCTGAGCTTCTTCTTGGAAAGCCAGTTTTTCCAGGAACCTCA
ACTCTGAATTAACTTGATAGAGTGATGGAGCTAATTGGAAGACCTTCATAAGATGATATC
GAGGCTATCGAATGTCCCCTTGCTATGACTATGCTTGAGCAACTCCCACCTAGAAAAGCC
AAAAGATTTAGAGATGTATTCCCAACAGCCAGCGATGATGCTCTAGACCTTCTCAAGTCT
CTTCTTCATTTTAACCCTGACAGAAGATTGACAGCTGAATAATGCTTGAAACATCCATAT
GTTGCTCAATTTCACAATGAAGAGGATGAACCTAACTGTAAAAAGAAAATTAACATCCCA
ATTGATGACAACCAAAAATTCTCAATTAGAGAGTACAGAAATAAGCTCTATGCTGATATC
CACAAAAGAAAGAAGGAAATTAGAAAGAAGATGTTGCAATCTCACCATAATCAGTATTAC
AGCGCATCTTAAACGAACAAGTAATATAAGCAATGA


>Contig194.1.g74(protein)
MTEEIEAHVLKKYEILQKLGKGAYGIVWKAIDKKTKDIVALKKNFDAFQNATDAQRTFRE
IIFLQELNGHENIIRLQNVIRAENDRDIYLVFDFMDTDLHAVIRANILEDIHKQYIMYQC
FKSLKFMHSANLLHRDLKPSNLLLNSECHVKVGDFGLARSLDVRDPDTVPLLTDYVATRW
YRAPEILLGSNKYTKGVDMWSMGCILAELLLGKPVFPGTSTLNQLDRVMELIGRPSQDDI
EAIECPLAMTMLEQLPPRKAKRFRDVFPTASDDALDLLKSLLHFNPDRRLTAEQCLKHPY
VAQFHNEEDEPNCKKKINIPIDDNQKFSIREYRNKLYADIHKRKKEIRKKMLQSHHNQYY
SASQTNKQYKQ