Identifiers and Description

Gene Model Identifier

Contig19394.0.g62

Standard Name

None

Aliases

Contig19394_0_g62

Description

Chitin synthase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR038W2.9992141389250636e-57CHS2 SGDID:S000000242, Chr II
from 311898-314789, Genom...
T. thermophilaTTHERM_005999404.999456391042964e-45Chitin synthase family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19394.0.g62(coding)
ATGACTGATAACAAAGCAGCGGTTAAAGCAGTCGGATAATAGTAAACAGCTCCCAATCAA
ACTGCTAGTAAATTCAAGGTCGCGAATGATGATTTAAAAAATTAACTGCTCACATAAAAC
GACGATGAAAAAGGCACTCCCTTTTTGAACATACATGAAAATACACTGGGTATCACTGAT
ATATAGTAAGATGTTTGGAAGCCTTCTAGAATGCATTCTTATGAGACAATGGCTTTGGCA
GACAGTTAACTAAATTGCAAAATTAGACCATGTGGATTCCGAGCAAATGGCAATATGAGA
AAGATTAAAAATACCTGCTTACTCTCTAAAATAAAGACAAAATGTAGATTGAGAGGTAAG
AATCCCAAATTAGCTGTATGTATCACCATGTATAATGAAAATGAAAACGAGCTAAAGGAT
ACACTTTCAGGTGTATTGTAAAACTATAATGAGCTCAGATTGGACAAATCTCTTGACTTT
AAAAAAGAAGATTTTGTTGTTTTCTTAATCTGTGATGGTTACTAAGCAATACCAGAGTCA
TTCAAGTAGTACGCAACTAAGCATCAATTCTTTGATGAAGATGTTCTTTGGGCAAAGAAG
TTTATGGATAAAGACCGTGACGGAAAAATTAAGATGAAAGATATGAGAGACATTATGGAG
CCAGGAGTATCAAAAGTTCCATTGAATCTGATTCATATGTTCTAAGTTTAATCATGGGAT
TTTGGACTCTAAGATGACACACTTAAGAGTAGAAGGATCAATTTCATCTTTGCAATTAAA
TAAAGAAACGATGGTAAAATCAACTCACATAAATGGTTCTTCTAAGGCTTGTGTAAATTC
TTGAAACCTGAACTGTGTCTCATGTTAGATGTCGGTACAAGAGCAGATAAGCACGCTGTT
TACAAGCTTTACAAATACATGTTGAAGCATGATTAGTGTGGTGGTTGTTGTGGAGAGATT
GAAGTAGATTTTTCTTAAGACAAGGGTATCTCTTCATCTTATTTTATCAAAGCTGCTCAA
TTCTTCGAGTATAAAATGGGACATTCCCCAGATAAAGCTTGTGAAAGTTTTTTCGGATTT
AATTCTGTGCTGCCAGGAGCTTATTCTCTGTTTAGATGGAAGGCAATAAAGGGTGAGCCC
CTAGATTAATTCTTTAAAAGTGTTACCAGAAGTGATTTACCATCATGTGCTGAAGCTAAT
GAATTCCTCGCAGAAGACAGGGTCATGTGCTTACAGATCTATATAAAGAAAAACCATAAA
TACCACTTGGCATATATTCCAGAAGCTAAGGCCTTCACAGATGCACCAGATTCATTATCA
ATACTAATCAAATAAAGGCGTAGATGGATGAATGGTGCTATGTTTGGTACAGTGAAAGTT
ATATCAAGCATGATTAACATGTTGAGTTGCAGAAGGACTAAGCATTCTTGGTATAGACAA
GTGATGCTCTTCTTCTTTTTATTCTATTACACAATAACTTTCTTGTTCCAATTCTTCACA
GTTGGTTCCATGTATGCTTCCATTACAATTTTCTTAAAATAATCATTTGGAAAACTTTTA
GAAAGCAATAATGCAGCACAATGGCTAATTGACTTAACAGAGTCCTTTTTTGATTACTTT
TATATTGCACTGGTTATGATGGCCATCATTATTTCTTTGACAACTACTGTTGATAGAGGA
GTGGGATGTGGTTTTTGGGTTTTGGTATTGAGTGGTGCTATTATGATGGGTGTATTTTTC
ATTCCTATGATCTTAAGACCTCTTGATTTCCTAAGTAATGTGAGAAACTACATAATGGGT
CTTTTTAGTTACCTGTTTATGATGCCAACTTTCATTAATATTATGCAAATCTATGCTATG
TGCAATTTGCACGATATTTCTTGGGGAAATAGACCTACCACTTAAGCTCAGGGAGTTGAA
GCTGTAACTTATAATGTAGCAGCACAGGAGAAACTTAAATAAGATTACTAAGTATTCAGA
GCATATTTCTTGTACTTCTGGCTTATATCAAATGCCCTCTTTGGAGGCTTGACTGTATAT
TTAACATCTTCATAAAATCAATAAGTTATTAATGACGGCAATATCAATTTCATTGATGGC
TTTGCCCTTTTTGTCGCTGGTCTTGTTGTATTTAAGTTTGTATTCGCTCTGATTTACACT
CTTAAATGGAACTGCAGAAGATGTTGCAAATCTTACTATGGAAATGGTAAATTTGATTTT
GCTGAAGAATTTAAGCGTTTAAAGTAAGACAGACAAGGAGCTTACAGCACCGACGAAGAT
GATGACGATTATGATGAAAGCAAGGCCTTTAATGCAAAAGAAACAGGAGGATCAGTGAAT
CAAATTTTCAAGAAAGGTGAGGACGGCAGTATCAGCATAACAAAAGACAATCACGAGATT
GACGATTCAGATAACGATGATGATGAATTTGAGGATGCAAATGAAGAGGAGAAGGAAGAT
TTCCTTCATTAATCGATGAACAGAAGCAGTCGAAGATTCACAAACATATCAAGAGCACAA
GAGTAAAGGCTAGACAACACTTAGGGCACTATCATGATGAAACTCAATGATAACAACACT
ACAAATGCCCTTGAAAACACTTAAATGATGGTTATTAGTTAGCATGAATAGAATTAATCG
AATTTCATATTCAAGAGTTAAAGACCTCACATAGAAAGTGCAGTCTCTTACGATCATAAT
GATCCTAATGGTATAACCAGTCGAGGAGTTTCTATGGGAAAACCTATTCTTAGCGGCAAA
AACACTTATGAAGACTCAAACTTAAAAGCAAACTTTGATCCTAATTCTTTTGGAGTAAGA
TAAGGCAATACAAATGATATTTACATGGATTATCCTCAAAATACAGATTAAAACACTAAG
AACACTTAACCAACACCTGTTAAGAGAGATTCAAATGCTACTCCTAAGTTCACTTTAGGG
CAGGCATTTGGAGAGAGTGAGCAATCAAAATAGAAGAAATCAGTCAGATTTAACGCACCA
AAGGGAATGTGA


>Contig19394.0.g62(protein)
MTDNKAAVKAVGQQQTAPNQTASKFKVANDDLKNQLLTQNDDEKGTPFLNIHENTLGITD
IQQDVWKPSRMHSYETMALADSQLNCKIRPCGFRANGNMRKIKNTCLLSKIKTKCRLRGK
NPKLAVCITMYNENENELKDTLSGVLQNYNELRLDKSLDFKKEDFVVFLICDGYQAIPES
FKQYATKHQFFDEDVLWAKKFMDKDRDGKIKMKDMRDIMEPGVSKVPLNLIHMFQVQSWD
FGLQDDTLKSRRINFIFAIKQRNDGKINSHKWFFQGLCKFLKPELCLMLDVGTRADKHAV
YKLYKYMLKHDQCGGCCGEIEVDFSQDKGISSSYFIKAAQFFEYKMGHSPDKACESFFGF
NSVLPGAYSLFRWKAIKGEPLDQFFKSVTRSDLPSCAEANEFLAEDRVMCLQIYIKKNHK
YHLAYIPEAKAFTDAPDSLSILIKQRRRWMNGAMFGTVKVISSMINMLSCRRTKHSWYRQ
VMLFFFLFYYTITFLFQFFTVGSMYASITIFLKQSFGKLLESNNAAQWLIDLTESFFDYF
YIALVMMAIIISLTTTVDRGVGCGFWVLVLSGAIMMGVFFIPMILRPLDFLSNVRNYIMG
LFSYLFMMPTFINIMQIYAMCNLHDISWGNRPTTQAQGVEAVTYNVAAQEKLKQDYQVFR
AYFLYFWLISNALFGGLTVYLTSSQNQQVINDGNINFIDGFALFVAGLVVFKFVFALIYT
LKWNCRRCCKSYYGNGKFDFAEEFKRLKQDRQGAYSTDEDDDDYDESKAFNAKETGGSVN
QIFKKGEDGSISITKDNHEIDDSDNDDDEFEDANEEEKEDFLHQSMNRSSRRFTNISRAQ
EQRLDNTQGTIMMKLNDNNTTNALENTQMMVISQHEQNQSNFIFKSQRPHIESAVSYDHN
DPNGITSRGVSMGKPILSGKNTYEDSNLKANFDPNSFGVRQGNTNDIYMDYPQNTDQNTK
NTQPTPVKRDSNATPKFTLGQAFGESEQSKQKKSVRFNAPKGM