Identifiers and Description

Gene Model Identifier

Contig19301.0.g14

Standard Name

None

Aliases

Contig19301_0_g14

Description

ATP synthase alpha/beta family, nucleotide-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex (IEA) | GO:0016469
  • proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178

Molecular Function

  • ATP binding (IEA) | GO:0005524
  • hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820
  • proton-transporting ATP synthase activity, rotational mechanism (IEA) | GO:0046933
  • proton-transporting ATPase activity, rotational mechanism (IEA) | GO:0046961

Biological Process

Domains

  • ( pfam00006 ) ATP synthase alpha/beta family, nucleotide-binding domain
  • ( pfam00306 ) ATP synthase alpha/beta chain, C terminal domain
  • ( pfam02874 ) ATP synthase alpha/beta family, beta-barrel domain
  • ( pfam13173 ) AAA domain
  • ( pfam13289 ) SIR2-like domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003396409.997093137033517e-262V-type ATPase, A subunit famil
y protein
SGDYDL185W8.998537725811687e-130VMA1 SGDID:S000002344, Chr IV
from 126787-130002, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19301.0.g14(coding)
ATGGAAGACTACGATCAACCAGAGAGCAAATACGGTAGAATCTACAAAGTGGCAGGACCA
TTGGTCGTTGCTGAGAAAATGTCAGGATCAAAGATGTACGAACTTGTTAAGGTTGGCTGG
GATAGACTGGTCGGAGAGATCATTAAACTCGAGGGAGATACCGCTTCTATTCAGTGCTAC
GAAGATACTTCTGGTCTTACTGTTGGAGATCCAGTGTACAGAACAGGAAACCCACTATCA
GTCGAACTCGGTCCCGGTATCCTAAAAACTATTTTTGACGGTATTCAAAGACCTCTTGAG
ACTATCGCTAAAAATTCAGGAAGTGTTTTCGTACCAAGAGGTGTTGATGTCCCATCATTG
GATTAAGTTAAGCAATGGGAGTTCACCCCTACTACTAAGTTCAAGGTAGGAGATTTGATC
ACAGGAGGTGATGTTATCGGATCAGTCTTTGAGAATGATCTCTTTAATGAGCACAGAATC
ATGCTTCCACCAAAGGTTTACGGAAGAATCAAGGAAATCATGCCAAAGGGTATGTATACT
GTCTCACAACCAGTCGTTGTTGTTGAATTCGAAGACAAGGAAAAGGAAGTCAACATGAGT
CATTTCTGGCCCGTCAGACAGCCAAGACCAGTTGCTGAGAAACTTGCTGGCAAGACTCCA
CTCCTCACAGGACAAAGAGTTCTTGATGCTCTTTTCCCAACTGTCCAAGGTGGTACTTGC
GCTATTCCAGGTGCTTTTGGTTGTGGTAAAACTTGTATTTCCCAGGCTCTTTCAAAGTAC
TCTAACTCAGAATGTATTATCTATGTCGGTTGTGGTGAAAGAGGTAATGAAATGGCTGAG
GTACTTTAAGAATTCCCAGAGCTCTCAATTGATATTGGTGGAAAGAAATACGATATCATG
TAGAGAACTTGCTTGGTCGCAAACACATCTAACATGCCTGTCGCTGCCAGAGAAGCCTCT
ATTTATACTGGTATTACTCTTGCTGAGTACTTCAGAGATATGGGATTCAACGTTGCTATG
ATGGCAGACTCCACTTCACGTTGGGCCGAAGCCTTGAGAGAAATCTCTGGTCGTCTCGCT
GAAATGCCAGCTGATTCAGGTTATCCAGCTTATCTTGGAGCTAAATTAGCACAGTTCTAC
GAAAGAGCTGGTAGAGTTAAGTGTCTCGGTTCACCAGACAGAGAAGGTTCAGTCTCTATT
GTCGGTGCCGTCTCACCTCCAGGTGGTGATTTCTCAGATCCAGTTACATCATCAACTCTT
GCTATCGTGCAAGTCTTCTGGGGTTTAGATAAGAAGCTCGCCCAAAGAAAGCATTTCCCA
TCACTCAACTGGTCTATTTCTTATTCAAACTATGACAGAATTCTTGAAGATTATTATAAT
CAATATGATCCAGAGTTCATGAAGGTCAAGACCAAGATCAGAGAAATTCTTCAAGAAGAA
GAGGATCTTACTGAAATCGTGCAATTGGTCGGTAAGGATTCCCTTTCTGAAGATCAAAAG
GCAGTTCTCGAAATCGCTAAGATTATCAGAGAAGATTTCTTGCAATAAAATGCTTTCTCT
ACCTACGATTACAACTGCCCACTTTACAAGACCCTTGGTATGATGAAGGCTATTGTTAAG
TTCTTCGAGAACTCCAAGAGAGCCATTAACGAATCACTCAAGAGTGAAAGAAAGATTTCA
TGGGCCATTATCAACAACTCAATTGAAAAGCAACTTCTCGAGTTATCTCAAATGAAATTC
AAGGACCCCATGATCCCACAAGAGGAAATGATGAGATACTTCAACGATCTTTTCGATCAA
ATCGACAACGAATTCAGAAGACTCATGCTTGGTTGA


>Contig19301.0.g14(protein)
MEDYDQPESKYGRIYKVAGPLVVAEKMSGSKMYELVKVGWDRLVGEIIKLEGDTASIQCY
EDTSGLTVGDPVYRTGNPLSVELGPGILKTIFDGIQRPLETIAKNSGSVFVPRGVDVPSL
DQVKQWEFTPTTKFKVGDLITGGDVIGSVFENDLFNEHRIMLPPKVYGRIKEIMPKGMYT
VSQPVVVVEFEDKEKEVNMSHFWPVRQPRPVAEKLAGKTPLLTGQRVLDALFPTVQGGTC
AIPGAFGCGKTCISQALSKYSNSECIIYVGCGERGNEMAEVLQEFPELSIDIGGKKYDIM
QRTCLVANTSNMPVAAREASIYTGITLAEYFRDMGFNVAMMADSTSRWAEALREISGRLA
EMPADSGYPAYLGAKLAQFYERAGRVKCLGSPDREGSVSIVGAVSPPGGDFSDPVTSSTL
AIVQVFWGLDKKLAQRKHFPSLNWSISYSNYDRILEDYYNQYDPEFMKVKTKIREILQEE
EDLTEIVQLVGKDSLSEDQKAVLEIAKIIREDFLQQNAFSTYDYNCPLYKTLGMMKAIVK
FFENSKRAINESLKSERKISWAIINNSIEKQLLELSQMKFKDPMIPQEEMMRYFNDLFDQ
IDNEFRRLMLG