Identifiers and Description

Gene Model Identifier

Contig19264.0.g57

Standard Name

None

Aliases

Contig19264_0_g57

Description

ATPase family associated with various cellular activities (AAA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001363609.997093137033517e-26226S proteasome subunit P45 fam
ily protein
SGDYOR117W9.997093137033517e-262RPT5 SGDID:S000005643, Chr XV
from 545029-546333, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19264.0.g57(coding)
ATGGATTAAAAGACTGTTGATCAAAAAACTAAAGCTGGTGGACTCGAATCTGCTGATGTA
TGGGGTGACTAAGACGATCCAATGAACGAAGTCAATGCTTTGACTAATGAAGAACTTGTT
TCTCGTACAAGGGAATTTGAAGGTGAGATTAGAAAGTCAAAGACCTAGATCACTCGTATT
ACCAACGAGATCAAGAACTACGACTTGCGTATCAAGGAGAACAAGGAAAAGCTCAAGATG
AGTTGTCAATTACCTCACATGGTTGCCAATGTAGGAGAAATCTTAGATGGGGAAGAAGAT
GAAGAGGATAAGGACACATCCGGTTTCTAGAATGATGCTCAAAACAAGAATAAGAAAGCT
ATGGTTGTGAAAACTACAGGCAGACATACTATTTATCTTCCAGTCATTGGTATGATCGAA
CCAGAAGAGGTGAGACCAGGCGATCTGATCGCAATCAACAAAGAAAGTTTCATTGTGTAT
GAGAAATTACCACCTGAATACGATTCAAGAGTCAAAGCTATGGAGATTGATGAGAGACCC
ACAGAAGAGTACTCAGATATCGGTGGTCTCGATAAGCAAATTCAAGAGCTGATCGAGGCA
ATTGTATTGCCAATGACTCATAAAGAGCGATTTGACAATATTGGTATCAGACCACCCAAG
GGTCTTCTCATGCATGGACCTCCAGGCACTGGTAAAACCATGATGGCCAGAGCTTGTGCT
GCTTAAACCAAGGCTACTTTCTTGAAGCTAGCAGGTCCATAATTGGTGCAGATGTTCATC
GGAGATGGTGCTAAGATGGTCAGAGATGCCTTCGAACTTGCCAGAGAGAAAGCTCCAGCT
ATTATCTTCATCGATGAGTTAGATGCCGTGGGAACCAAGAGAGGTTCAGGAGAGGGAGAG
ACCAGAGAAGTGCACAGAACTATGCTTGAATTGCTCAACTAGTTAGATGGTTTCACTCAA
GATGATCGTATCAAGGTTATTGCAGCAACTAATAGACCAGATATCTTGGACCCTGCTCTT
CTCAGATCTGGTAGACTCGATAGAAAGATTGAGTTACCACTTCCAAATGAAGAAGCCAGA
GCAAGAATCATGTAGATCCACTCTAGAAAGATGAATGTAAACAAGGAAGATGTAAACTTC
GAGGAGCTCGCTAGAAGCACTTAAGATTTCAATGGTGCTCAGTTGAAGGCAGTATGTGTT
GAGGCAGGTATGGTAGGTCTCAGAAGAGGAGCTACAACTCTTAGACATGAGGATTTCGTT
GAGGGTATTCAGCAAGTGCAGTCAAAGAAAAAGGCATCTCTAAATTACTATGCTTGA


>Contig19264.0.g57(protein)
MDQKTVDQKTKAGGLESADVWGDQDDPMNEVNALTNEELVSRTREFEGEIRKSKTQITRI
TNEIKNYDLRIKENKEKLKMSCQLPHMVANVGEILDGEEDEEDKDTSGFQNDAQNKNKKA
MVVKTTGRHTIYLPVIGMIEPEEVRPGDLIAINKESFIVYEKLPPEYDSRVKAMEIDERP
TEEYSDIGGLDKQIQELIEAIVLPMTHKERFDNIGIRPPKGLLMHGPPGTGKTMMARACA
AQTKATFLKLAGPQLVQMFIGDGAKMVRDAFELAREKAPAIIFIDELDAVGTKRGSGEGE
TREVHRTMLELLNQLDGFTQDDRIKVIAATNRPDILDPALLRSGRLDRKIELPLPNEEAR
ARIMQIHSRKMNVNKEDVNFEELARSTQDFNGAQLKAVCVEAGMVGLRRGATTLRHEDFV
EGIQQVQSKKKASLNYYA