Identifiers and Description

Gene Model Identifier

Contig19231.0.g39

Standard Name

None

Aliases

Contig19231_0_g39

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006945409.997093137033517e-262hypothetical protein
SGDYCR057C0.00000000019994075865167896PWP2 SGDID:S000000653, Chr III
from 223228-220457, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19231.0.g39(coding)
ATGCGTACATTGACAGCATGGCAGGATATGATTGTGAGATTCAAATTTTTAGTGTTTAAA
ATAACTTATATAGCCTGCTCCCCCTACAGATTCAAATCTAACTAATTGCGTATGGGCTAT
GGAGCTTAAGTCCTTGTGGCGGTTGCTGATAGAGTCTTCATTTATGACGCTCATTCAGGA
GAAATGATTAAGCAAACAAGAGGTCACAAAGACGCTGTATACTGTATTGCTTATTCAAAG
GATGGTTAGAAATTTGCTACAGGTGGTGCAGATAATTCAGTTGTTATTTGGTCAAACACT
GGAGAAGGTCTTTTGAAATATAACCACAATGACAAGATTTAATGCCTCGCTTTTAATCCA
GTTCTTCAAAACTTAGCTAGTTGCTCAACTATTGATTTTGGTCTTTGGCAAGCCGATCAA
CCAAATGTTAATAAGTAAAAGGTTCCAGCAAAATGCTGTGCATGTGATTGGTCACCAGAT
GGCCAACTCCTTGCAATTGGTCTGTTAAATGGACAAATTTTAATGAAAGACAAGACAGGA
GTTGAGCTTTTTGTTATTCAAAAGTCTGCTCAGGCAGTATGGTGCTTAGCATTTTGCACC
TAAAAGTTTGACACCTCTGACAACACTTTGATTGCTGGTTCTTGGGATCAAAAGCTTTCA
GTGTATCAACTTTAAGGAGGAAAACAGTATAAATAAGTTGGTAATGATAAAGAACTTGGA
TTTGATCCATGTGCAATCAGTTTTTATCCAACAGGAGAATATATGGCTATTGCTGGAAGT
GATAAGAAAATCACACTCTGGAATAAAGACGCAGTCCTACTAGGAACAGTAGGTGAGATG
AAGGACTGGATCTGGGCTCTAGCTGTCAGCCCAATCAATAAAAGCATCTTTTCAGGAGCT
AACAATGGAACCATAGCTATGCATAATGTTGAATTCAATACAATTCATGGTCTTTACCAA
GATAGATATGCCTACAGAGAATTAATGACAGATGTAATCATCTCTCATTTAGTAACTGAG
ACTAGAGTCAAAATTAGATGCAGAGATTATATCAAGAAAATTGCAATTTACAAAGACAGA
CTTGCTGTATAGCTACCAGAGAAGATCATTATATATTCAGTTTCTGGAGAGGATCCTTAT
GATATGAAATACAAAGCTTACAAGAAAATTAACAAGAAGATTGATTGCAATCTTCTTTTT
GTGGTATCTTAGCATCTCATCCTTGTTTTTGAAATGAAGATTCAGCTTCTTTCATTCAAT
GGTATTCTTGAAAGAGAATGGGTGCTTGATTCTAATATTAAGTATGTTAAGACAATTAGC
GGTCCTCCTAAAAGAGAGGGTCTTTTAGTTGGGTTAAAGAATGGAAGTGTAGTAAAGATT
TTTATTGATAACGGTTTCCCTATTCCTATTGTTAAACAAGCAACTCCCATTAAAGTAGTA
GATATTTCTTCAGATAGATAGAAAATTGCTGTAATTGATGAGTTCAACAGCATGTTCGTC
TATGACATCAAGTCTTAACAACTTCTATTCCAAGAAGTTAATATCTTCTCAGTAGCTTGG
AATATTGAAATGGAGGATATGATTGCTTATACTGGAAAAGATACTCTTTACATTAAGACA
AGAGAAATGCCTCCATCAACACAGAGACTTCCCGGTTTCGTAGTAGGATTCAAAGGCTCA
AAGATCTTTTGTTTGAATGGAACTTCTATGAATACTATTGATGTACCTCAGTCCTCTACT
TTCTATAGATTCTTAGAGAAAAAAGACTTTGCAATGGCATATAAAATTGCTTGCATAGGT
GTAACAGAATAAGATTGGAGGGCATTAGGTATTGAAGCACTTATTGATAAGAACTTCTAT
CTTGCCAGAAAGGCTTTCGTTAGAATAAGAGACCTTAAGTTCATAGATTTATCTGACTTA
GCAGAATAAATGAACAATATGAAGACTCTTAATGAACATTGGCTAATTGGGGAGATATTA
GCTTATTAAGGAAAATATAAGGAAGCAGTTCAATACTTTATCAAAAACAATTTACAAGAA
AAAGCAATTAACCTTTACACAACTTTAAAGAAGTTTACTGAAGCTAATGAGCTTATGAAA
AACATGCCAAACGGAAAGAGCGATCCGGTTATTATGTAAAAGTAAGCAGATTATATGAGG
GAGACTGGCTAGTGGAAAGAGGCAGCTGAGCTTTACTAATAAGCTGGAAAATATAAAGAT
GCTATTGAGATATATGGCAAGAGAGGTGTTTTAGACTCTGTAATGGAAGTTTGCAAGAAC
TTAGATAAAGCTAAAAATAAAGCAGAAATTGAACTTTGTGCAAAGTACTTCAGATAAGCT
GGTCATCACACATTTGCGAAATAAGCTTATTTAATGTTAGGAGATATTAAGGGACTTATG
GGACTGCATGTAGAACTACATAAGTGGGACGAGGCGTTTATGTTAGCAAAACAAAATACA
GATTTACAAAATGTTATCTACTTACCATATGCAGATTGGTTAAGTGCAAATGATAGATTT
GATGAGGCTTAAGAAGCCTACAAAAAGGCAGGAAGACCAGACTTATCCTTGAGAATTGTC
GAATTCTTAACTCATAATGCAGTTATAGAAAAGAGATTCTAAGATGCTGCTCAATATTAC
TGGATGCTTGCTGCCGAATCTATGTAACTGATAAAAGAAGCAACATAAAAAGCTCAAAAA
TAAGACACAAAATATCTTAAAAACTTTGAGGAGTATATGAAACTTGCTGAAATTTATTAG
GCTTATCAACTTATCCACAAATTTATTGAAGAAAGCTATTAAGCAGTCATCTAAGGACCT
CTCTTTAATGAAGCTATTTTTAATGCTTCAAGGTTCTTAGTTAGTAACTTAGGAAAGAGA
TAACCTCTCGGAATTAACAAAGTCTACATCTATTATGCTCTCAGCTATCTTGGGTATAGA
TTCGAAGCATTTAAGACTGCAAGATTTGGCTATGAAAAGCTTTAATCATTAAAAATACCT
ACAGCTTGGTAAGATGATATCGAACTTGCCAACTTAAAAGTTAGAGCGAAACCTTTCTCA
GACAAAGATGGATTCTCAGTGATCTGCAATAGATGCATGAACGTAAATGCATTGATCAAT
TAAAATGGGGATATTTGTACCTCTTGTGGTCATCCATTCTTAAGAAACTTCATAGGCTTT
GATACATTACCTTTGGTTGAATTTTAGCCAGACTCTAAAATTCCTCACAAAAAGGTACTC
GAGTTTTTGAAAATGGATCCTCCTGAAGAAGTTAATGGTGCAGTTAAGCCAGCTCCAAAA
AAGAAGCAAATTCGTGACGCAGGATGGCAAGAAGATGGAGATGAGCAGACAATGAATTTC
TAACAGCCAGATTATGGTGATGACTTAGAAAATGATCTTTTCACTTAAAAAATGCTTGAA
TGGCTTGAAACACAAGTTACAGCTGATTCTTACAAGCCAGTTGAGGTTGATGAAAGAATT
CTTAAATCTTTGAGATATGAAGAAATTTATATTGTTGACTACTCTTAATACTGTCCAACC
CTCCCAAAGAAATTCTACAAAAATATGGTTCCAGACGTTGCCATAACATTATGCGATAAA
TGTTGCAAGTTTTTCATGTAAGATGAATATGAATTTGCATATATGGAAAAGGGATGCTGT
CCATTCTGCAAGAATGTTGAAAAAGACAAAGGTGTAAAGAATGTTTACGGAAGTCTTGCT
GATATTAACAGATGA


>Contig19231.0.g39(protein)
MRTLTAWQDMIVRFKFLVFKITYIACSPYRFKSNQLRMGYGAQVLVAVADRVFIYDAHSG
EMIKQTRGHKDAVYCIAYSKDGQKFATGGADNSVVIWSNTGEGLLKYNHNDKIQCLAFNP
VLQNLASCSTIDFGLWQADQPNVNKQKVPAKCCACDWSPDGQLLAIGLLNGQILMKDKTG
VELFVIQKSAQAVWCLAFCTQKFDTSDNTLIAGSWDQKLSVYQLQGGKQYKQVGNDKELG
FDPCAISFYPTGEYMAIAGSDKKITLWNKDAVLLGTVGEMKDWIWALAVSPINKSIFSGA
NNGTIAMHNVEFNTIHGLYQDRYAYRELMTDVIISHLVTETRVKIRCRDYIKKIAIYKDR
LAVQLPEKIIIYSVSGEDPYDMKYKAYKKINKKIDCNLLFVVSQHLILVFEMKIQLLSFN
GILEREWVLDSNIKYVKTISGPPKREGLLVGLKNGSVVKIFIDNGFPIPIVKQATPIKVV
DISSDRQKIAVIDEFNSMFVYDIKSQQLLFQEVNIFSVAWNIEMEDMIAYTGKDTLYIKT
REMPPSTQRLPGFVVGFKGSKIFCLNGTSMNTIDVPQSSTFYRFLEKKDFAMAYKIACIG
VTEQDWRALGIEALIDKNFYLARKAFVRIRDLKFIDLSDLAEQMNNMKTLNEHWLIGEIL
AYQGKYKEAVQYFIKNNLQEKAINLYTTLKKFTEANELMKNMPNGKSDPVIMQKQADYMR
ETGQWKEAAELYQQAGKYKDAIEIYGKRGVLDSVMEVCKNLDKAKNKAEIELCAKYFRQA
GHHTFAKQAYLMLGDIKGLMGLHVELHKWDEAFMLAKQNTDLQNVIYLPYADWLSANDRF
DEAQEAYKKAGRPDLSLRIVEFLTHNAVIEKRFQDAAQYYWMLAAESMQLIKEATQKAQK
QDTKYLKNFEEYMKLAEIYQAYQLIHKFIEESYQAVIQGPLFNEAIFNASRFLVSNLGKR
QPLGINKVYIYYALSYLGYRFEAFKTARFGYEKLQSLKIPTAWQDDIELANLKVRAKPFS
DKDGFSVICNRCMNVNALINQNGDICTSCGHPFLRNFIGFDTLPLVEFQPDSKIPHKKVL
EFLKMDPPEEVNGAVKPAPKKKQIRDAGWQEDGDEQTMNFQQPDYGDDLENDLFTQKMLE
WLETQVTADSYKPVEVDERILKSLRYEEIYIVDYSQYCPTLPKKFYKNMVPDVAITLCDK
CCKFFMQDEYEFAYMEKGCCPFCKNVEKDKGVKNVYGSLADINR