Identifiers and Description

Gene Model Identifier

Contig19158.0.0.g82

Standard Name

None

Aliases

Contig19158_0_0_g82

Description

Mitochondrial carrier protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010145501.999598840915195e-17Mitochondrial carrier protein
SGDYGR096W0.0000000000000299873730555305TPC1 SGDID:S000003328, Chr VII
from 676621-677565, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19158.0.0.g82(coding)
ATGAACAAACTATTTGAAAAGGCTAAATATGGATTGAATTTTATGCACTTTCATAGAAAA
AGAGTGTTTGTTGCTTCTGCTTTCGTATCAGGATATGGCTTTGCGTGCTATAAATGGAGA
AATCATCCTAATGAAATAATAAGAATGGGAATAGCAGGATCATTGGCATATTTAATTGTG
GAATCGATGTTTCATTTTGTAGACACAGTTAATGTTAGAGCAAAGTTAAGTGAAACCAAT
GTTTCTTCCCTAAACATGGCAAGGAAAATTTATAGAAGTGAGGGTCTTTATGGGTTTTCA
AAAGGTTTTTCAGCTATGTTTTATGGGTCCGTTGCATGTGGGTTCATTTATTTCTCGCTC
TATAAGTTATTCAAATAGTATTTCAAGGAAAAGCTTGGCGATGAATACAATATCGCATGG
ACTTTCTTTTTAGCATCCTTTGTTGCTGAATTTTTCACCTTAATCTTTTACTATCCTTAC
GACTTGGTGAAGTGTAGATTACAGTCTGGCAACTATCAGTTCAAATATAGAAACATTCCT
CATGCCTTCCGAAAAGAAATAAAGCAAGGTTCCATTCTCTCACTTTACAAAGGATCAATG
CCATTTCTAACAGCTTACACCGTGAGTGTATCCCTTCAATTCACCATTTATGAATACGTA
ATCACATTTTACAAGCGTCTCTACGGAGAGAATTATAGTCAAATTGAGTTAACTTCAAAT
ATAGTAGCTTCCTTCCTAGGTGGAGTCATAAGTAGTGCTCTCACAAATTCATTAGAGGTA
TTAACTTTGTAAAAATAAGCAAATCCTGAGGTAAAGCTACTGCAAATCATAAAGCAAGAG
AGGATCAAGTTATTTTACAAAGGATTAAGCGCGAGAGTTTTATATCATAGTTTTTAATCT
ATAGTGTTCTTTAATTTGGTAAACTAGATTGGAAAGATATACAATGTTGAACTAAGTGAT
GATTGA


>Contig19158.0.0.g82(protein)
MNKLFEKAKYGLNFMHFHRKRVFVASAFVSGYGFACYKWRNHPNEIIRMGIAGSLAYLIV
ESMFHFVDTVNVRAKLSETNVSSLNMARKIYRSEGLYGFSKGFSAMFYGSVACGFIYFSL
YKLFKQYFKEKLGDEYNIAWTFFLASFVAEFFTLIFYYPYDLVKCRLQSGNYQFKYRNIP
HAFRKEIKQGSILSLYKGSMPFLTAYTVSVSLQFTIYEYVITFYKRLYGENYSQIELTSN
IVASFLGGVISSALTNSLEVLTLQKQANPEVKLLQIIKQERIKLFYKGLSARVLYHSFQS
IVFFNLVNQIGKIYNVELSDD