Identifiers and Description

Gene Model Identifier

Contig19116.0.1.g102

Standard Name

PRP9

Aliases

Contig19116_0_1_g102

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006492804.9996115996408327e-110splicesome-associated protein,
putative
SGDYDL030W9.995528898049344e-31PRP9 SGDID:S000002188, Chr IV
from 397537-399129, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19116.0.1.g102(coding)
ATGACAAGTTCACGATTGGAATTGCTAAGAGGCGACTTTGAGATGGTCGAGAGTATGGAG
AAAGCTCTCGCTTAAGCATTCACCTATAAGGATAAATATCCAAAAGAGACTGTAATCTGT
GACATATTGATATCAAAATTCTAGACTATTATTCAGCAAAAGAGTCAAGAAATTTTAGAT
ATTTATAGTGACTACGATGGCCTTTTTAGAGAAGAAAATGACATTTTTAGTGGGTAGAAG
TTTGCTTCAGATTAGCAGTAGTAGAGAGCGTTTTAAACTCAATACTAAATGATGTAAGCT
GTCCCACAGGGTCAAGAAGTGCCCCAAATTAAATCAGATGTTTGGGGGAATTTCTACGAA
AAATACCAAGAAGTAGAGCAGTTCAATGCAAAGTACAACTAGGGAGCTCTAATCGCAGAC
AACGACAATCTAGACGCCGAGGCCATGTTCAATAAAATCATGGAGGAAATTATTGCATAC
TGTGATAAGACTTTCACTGCAGAGGAGGGAAATGGCAAGTACTTCGATTTGCATAGTCTG
TATTTGTAGTTCTGTAACATCAAGAAGTTGAGGAAGCATAATTCAATTAAATCTGATGAC
TATTTGACATGGCTGTAGAATTTTGATAAGTTCTTCAAGGTACCACTCTATCTCAAAAAT
TCTACCAAATACGAGGAATATCTGAAAAATCTTAAAGCATACTTAGTAGATTTCTTCAAA
AAGACTCAACCACTAATTGATTGGAATAAGATTTAAGTTTAATAAGATGAAGTTTTCAAA
TCTGAATGGGAGCAAGGCAGTTTGTTTGGTTGGGAAGATGTTATTAACAGAATCTAAGGA
AGTGTCTCAGAAACAAATGAAAACGATACTTTGGATTAAAATGGTCAGAAACCCCAAAAC
CCCTTGTACTGTGCTGCTTGCAACAAGATATATGCTAATGAAAATGTGTTTATGCATCAT
AAAAAAGGCAAATTTCATATCAAAGCTGTGAATTAAATGGGTTAGAAATTAGCTTAGACA
CAAGCAAATGATGGTCAATAGGATAATGCAGATAAAGCAATAGTGAGAAGTGAGTTTTCT
GAGAGTCAAAAGCATAAGTACAAAAATATTGCTGATCTTGAGACTTGGATACTTAGAATG
AAGGAACTATTGAGTGATGTGTTCATAGCTACAGAGAATCTCGTAAGAAAGAAGCAATCA
AAACATTACACTGAAATTGAGGCAGATTATGAGATGAACTCAGATATCAGAAACCCACTG
CTAGGTGGAGGCAAGGACAGACCAGCTGGAGGCTCAGACGACGAGGACGACGAGCGACCC
AAATACAACCCCAAGAACCTTCCAATGGGCTGGGATGGCAAGCCAATTCCCTACTGGTTG
TATAAACTGCACGGACTTGGAGTTGAGTTTAAATGTGAGATTTGTGGTGGTGCTAGTTAC
TGGGGTCGCAGATCCTTCGAGAAGCATTTCCAAGAGTGGAGACACGCCTATGGAATGAAA
TGCCTCAAGATCCCAAACACAGTTCACTTCAAGGATGTCACAGACATCGAACATGCTCTC
AGACTCCATAAGAAAATCCTCTCTGATAACTTTGAGAGCACATTCAAGCCAGATTTCCAG
GAGGAGTTTGAAGATGAGGACGGAAATTTATACTCAAGAAAGGAATACATAGATCTCAGA
CGCCAAGGAATCATTAGAAGATGA


>Contig19116.0.1.g102(protein)
MTSSRLELLRGDFEMVESMEKALAQAFTYKDKYPKETVICDILISKFQTIIQQKSQEILD
IYSDYDGLFREENDIFSGQKFASDQQQQRAFQTQYQMMQAVPQGQEVPQIKSDVWGNFYE
KYQEVEQFNAKYNQGALIADNDNLDAEAMFNKIMEEIIAYCDKTFTAEEGNGKYFDLHSL
YLQFCNIKKLRKHNSIKSDDYLTWLQNFDKFFKVPLYLKNSTKYEEYLKNLKAYLVDFFK
KTQPLIDWNKIQVQQDEVFKSEWEQGSLFGWEDVINRIQGSVSETNENDTLDQNGQKPQN
PLYCAACNKIYANENVFMHHKKGKFHIKAVNQMGQKLAQTQANDGQQDNADKAIVRSEFS
ESQKHKYKNIADLETWILRMKELLSDVFIATENLVRKKQSKHYTEIEADYEMNSDIRNPL
LGGGKDRPAGGSDDEDDERPKYNPKNLPMGWDGKPIPYWLYKLHGLGVEFKCEICGGASY
WGRRSFEKHFQEWRHAYGMKCLKIPNTVHFKDVTDIEHALRLHKKILSDNFESTFKPDFQ
EEFEDEDGNLYSRKEYIDLRRQGIIRR