Identifiers and Description

Gene Model Identifier

Contig19103.0.g52

Standard Name

None

Aliases

Contig19103_0_g52

Description

Eukaryotic aspartyl protease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001283208.996246542595932e-80Eukaryotic aspartyl protease f
amily protein
SGDYPL154C5.9981191891941984e-64PEP4 SGDID:S000006075, Chr XVI
from 260931-259714, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19103.0.g52(coding)
ATGCAAAAACTTGCTCTTATCTTGCTCCTCGCCTCATCAGTGCTCACTGCTAAGATTCCC
CTTAGAAAGCAAAAGCTCATGAAGGAGAACGTTTTGACTTTCAGAGACAGACTTGCCAGA
GGCACCAGCTCTGCTTACCTCGACAACGGTCTCGGTTCCAACATCCCAGTTAAGGATTAC
ATGAACACTCAATATTTCGTTGATGTTTCAATCGGAACACCATCTCAAACTTTCACTGTT
GTCCCCGATACAGGTTCATCAAACTTGTGGGTTTACTCAAGCAAGTGCTTCAACCTCGTC
TGCTTGTATCACTCAAAGTACGACTCAAGCAAATCAAGCACCTACACTAAGAACGGTGAG
AGATTCGGCATTACCTACGGATCTGGATCCATCGAGGGAACAGTCTCTCAAGATGTAACC
AGCCTTGGTGACTCAAATGCTCCAATGAGCTTCGGTGAAATCACCGCTGCCTCAGGTCTT
GCTTTCTACGCATCCCAAATGAGCGGTATCCTTGGTCTTGCCTACGATACTATCTCAGTC
GACCACCTCCCAACCTTCGTTGACCAAAGCAACCAAAAGGACAAGAGTTTCGCCTTCATG
CTCCACGAAAACCCAGAGTCATCTTACTTGACCATGCCAGGTTACGACACTGAAGCCGTT
GGAAGCAACGAATTCCAATTCCATAACGTCGTTGAAGACAAGTACTACTCCCTCAACCTC
ACCGGTCTCAGACAAGGATCAACTCAAATCCCATCTGACCACTTCAAGGCTGTCATCGAT
TCAGGTACTTCAGTCCTCGTCGGTCCAAACACCCTCGTCCAACCTTTGATCAAGGGCATC
ACCGTCAACGAAGACTGCTCAGGCATTGAAGCACTCCCAGAAATCGCTTTCTACATCGAC
AACATCGAATACTCCCTCGCCCCCAACGACTACGTCTTGAAAGTTACCCAAGGTTCAGAC
ACCCAATGCGTCCTCGCCGTTATGGGACAAGACTTCCCATCAGGATTCAACTACTTCATC
CTCGGAGACACCTTCATGAGAAAGTACTACTCATTCTTCGACAAGAACAACAACAGAGTC
GGTTTCATCCCAGCTGAGAAACTCAACACCAAGCAATGA


>Contig19103.0.g52(protein)
MQKLALILLLASSVLTAKIPLRKQKLMKENVLTFRDRLARGTSSAYLDNGLGSNIPVKDY
MNTQYFVDVSIGTPSQTFTVVPDTGSSNLWVYSSKCFNLVCLYHSKYDSSKSSTYTKNGE
RFGITYGSGSIEGTVSQDVTSLGDSNAPMSFGEITAASGLAFYASQMSGILGLAYDTISV
DHLPTFVDQSNQKDKSFAFMLHENPESSYLTMPGYDTEAVGSNEFQFHNVVEDKYYSLNL
TGLRQGSTQIPSDHFKAVIDSGTSVLVGPNTLVQPLIKGITVNEDCSGIEALPEIAFYID
NIEYSLAPNDYVLKVTQGSDTQCVLAVMGQDFPSGFNYFILGDTFMRKYYSFFDKNNNRV
GFIPAEKLNTKQ