Identifiers and Description

Gene Model Identifier

Contig19092.0.g43

Standard Name

None

Aliases

Contig19092_0_g43

Description

Papain family cysteine protease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00112 ) Papain family cysteine protease
  • ( pfam08246 ) Cathepsin propeptide inhibitor domain (I29)
  • ( pfam03051 ) Peptidase C1-like family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001611301.9995118794191673e-87Papain family cysteine proteas
e containing pr...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19092.0.g43(coding)
ATGAGATCTTCAGTTATCACACTCGCCGTCGTCGGTACCGTCGCTGCCATCGCAGTCGTC
GCTCTCTCAGAGATGCCATCATCAACCTCCCTCTACACCATGGAGGTCACCCAAGAGAAC
GTTGATTTCGCCAACTACCTCGCTAAGTACGGCAAGTCATACGGCACCAAGGAGGAATTC
CAATTCAGATTCCAACAATATCAATAAAACATGGCCCTCATTGCTCACCACAACAGCAAC
AACGAGAACACTTTCACTCTTGCCTCCAACAAATTCGCTGACTACACCCCAGCTGAATAC
AAAAAGCTTCTCGGTTACAAGAGAATGCCAAAGGCCAACGCTCAATACGCTGAATTCGAC
TTGACCGCTGTCCCAGACTCCATCGACTGGAGAACCAAGGGTGCAGTCACCCCAGTTAAG
GATCAAGGCCAATGCGGTTCATGCTGGGCCTTCTCTACCACCGGTTCACTCGAAGGTAGA
GACGCTATTGCCACTGGTACCCTCCAGAGCTACTCAGAGCAACAACTCGTTGATTGCGAC
TACTCAACCGACGGTAACCAAGGTTGCAATGGTGGAGATATGGGTCTCGCTATGGACTAC
TCAGCCAAGAACCCACTTGAACTCGAGTCAGACTACCCATACAAGGCTATTGATGGTAAA
TGCTCATACAAGGCTGACAAGGGTCACTCAAAGAACAAGGGTCACACCAACGTTAAGCAA
AACTCACTCCCAGACCTCAAGGCCGCCATTGCCCAAGGTCCAGTTTCAGTTGCTATTGAG
GCTGACACTATGGTCTTCCAATTCTACAACGGTGGTATCCTCAACTCCAAGTCATGCGGA
ACCAACCTTGATCACGGTGTCCTCGCTGTTGGTTATGGCTCAGAGAACAACAAGCCTTAC
TACATTGTCAAGAACTCATGGGGTCCATCATGGGGAGAGCAAGGTTACCTCAGAATCGCT
CAAGTTGACGGTGCAGGTATCTGCGGTATCCAAATGGAACCAGTATTCCCACAACTCTGA


>Contig19092.0.g43(protein)
MRSSVITLAVVGTVAAIAVVALSEMPSSTSLYTMEVTQENVDFANYLAKYGKSYGTKEEF
QFRFQQYQQNMALIAHHNSNNENTFTLASNKFADYTPAEYKKLLGYKRMPKANAQYAEFD
LTAVPDSIDWRTKGAVTPVKDQGQCGSCWAFSTTGSLEGRDAIATGTLQSYSEQQLVDCD
YSTDGNQGCNGGDMGLAMDYSAKNPLELESDYPYKAIDGKCSYKADKGHSKNKGHTNVKQ
NSLPDLKAAIAQGPVSVAIEADTMVFQFYNGGILNSKSCGTNLDHGVLAVGYGSENNKPY
YIVKNSWGPSWGEQGYLRIAQVDGAGICGIQMEPVFPQL