Identifiers and Description

Gene Model Identifier

Contig19063.0.g74

Standard Name

None

Aliases

Contig19063_0_g74

Description

Sir2 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010184501.0001788721085356e-149transcriptional regulator, Sir
2 family protein
SGDYOL068C0.00000000000040012475857291343HST1 SGDID:S000005429, Chr XV
from 201879-200368, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19063.0.g74(coding)
ATGGCTGATACAGCAATTAAGAGTGAAGAAGAAAAGAAAGAATATTTCGATTCTCCAGAG
GAGCTCAATTAAAAAGTTGAAATGCTAGCTTTATGGATTAAATCATCTGAACATTTCGTA
GCTTTCACAGGAGCAGGTATATCTACTTCTGCTGGAATCCCTGATTTCAGAAGTGGATCT
AACACAGTTCTTGAGACAGGTCCAGGAGTCTGGGAAAAAGCTGCTTTTAAAAAGGCAACT
GCTGATAAAAAGGTAGCGAGAGTCTCAATTTAAAAGGCAGTGCCAACTTCAACTCACATG
GCTTTCGTCGATTTAATTGAGAGAGGTAACTTGAAATTCTTGATAAGTTAGAATGTCGAT
GGTTTACATCGTAAAAGTGGGGTGCCTCCCGAAAAGATTGCTGAACTACATGGCAACACT
AACATAGAAATATGCACTAAATGCGAGAGAGAATTCTTGAGAGACTCAAGAGTAAGAACT
GCTTAACATGTTTTTGATCATAAAACTGGCAGGAAATGTGATGACCCTAATTGCAAAGGA
GACCTCATAGATACTATAATCAATTTCAAAGAGAATTTAAGAGAAAAAGACTTGGATCTT
GGATTTGGTCATTCAGCAGTCGCTGATTTGCACCTTGTTATGGGAAGTTCATTGAGAGTA
ACTCCTGCTGCTGATATGCCTCTGACTACATTTGAGAAAGGTGGCAAACTTGTTATCGTA
AATCTATAAAAAACACCTCTTGACTATGCAGCTTCTTTGATAATTCATGGAAAATGTGAT
GAAGTTATGAGACTTCTAATGTAAAAGCTTGAATACGATATACCAGAATGGAGACTGTAA
CGTAGATTCTAAATTGAACAAACTATAAAATAAAACGGTGATAAATATCTTAAAATAAGA
GGAGTAGATGTTAATCTTTCCCCATACTCACTCTTTACTAAAATCAAAGTAAAACCCATA
AATGGATAAAAGACACCTGCCTAAGAATTAAAGAAAGAGCCATTTTCATATCTAATGGCT
GATGAAAGCGAAAAATATAACATTGAACTATTCTTCTAAGGGCATTATGAAGAGCCTTCA
TATAATGTGGAATTAGACTTAAAAGAACTAAAAGATAATAACAACTTATAAACATATTTG
ATGGTATATAACCCATTTTTAAGAGTATGGGAGTTTTGTGTCACTATTTGA


>Contig19063.0.g74(protein)
MADTAIKSEEEKKEYFDSPEELNQKVEMLALWIKSSEHFVAFTGAGISTSAGIPDFRSGS
NTVLETGPGVWEKAAFKKATADKKVARVSIQKAVPTSTHMAFVDLIERGNLKFLISQNVD
GLHRKSGVPPEKIAELHGNTNIEICTKCEREFLRDSRVRTAQHVFDHKTGRKCDDPNCKG
DLIDTIINFKENLREKDLDLGFGHSAVADLHLVMGSSLRVTPAADMPLTTFEKGGKLVIV
NLQKTPLDYAASLIIHGKCDEVMRLLMQKLEYDIPEWRLQRRFQIEQTIKQNGDKYLKIR
GVDVNLSPYSLFTKIKVKPINGQKTPAQELKKEPFSYLMADESEKYNIELFFQGHYEEPS
YNVELDLKELKDNNNLQTYLMVYNPFLRVWEFCVTI