Identifiers and Description

Gene Model Identifier

Contig19010.0.g64

Standard Name

HP1c

Aliases

Contig19010_0_g64

Description

Chromo (CHRromatin Organisation MOdifier) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

  • ( pfam00385 ) Chromo (CHRromatin Organisation MOdifier) domain
  • ( pfam01393 ) Chromo shadow domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001252800.00000006998394348458725Pdd1p, a novel chromodomain-co
ntaining protei...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19010.0.g64(coding)
ATGGTAAAAAAGACATCAGCTAGACTGCAGAGCAACGGAGGCCCCATCCTTGGCTATGCC
AATCAAGACGACTACCTCGATGAAATTATTGGGGATGCCAGCATCAAAGAAGCTAAAAGA
CAAAAAATGCCTGGGAAAGTTGCTTAGTAAAAACCTGGAAGTGGAGTTCCAGGGGGAGTG
GAAAATGACAGCAGCAGTGAAGATGACAATTTCTTCGCAGTCGAGAGAATTATAGATAAA
AGGCAGAAGGGCAAAAGAGTTCAATATCTGGTTAAGTGGGAGAACTACGGGGAGGAAGCA
AATACTTGGGAGCCAGTTTCAAATCTCAGAAATGTGAAAGATTTGATAGTCGAATTTGAG
AAGAAAATTGAGATGCAGGTAAACATTAATAATTAAAGCAGCAGTACATGCATCTCAAAC
CATGCTGCTATTTCCAGTGGCCAAGGAGATATGCAAATGCAAAATGTAAGTGGGTAAACA
TCAGAAAACACAAAAAACAACAACGCTAATAATAAATACGGAACCTCATTAAACTCAAAG
GTTATTAAGAAATAAATTAAGTTGAAGGAGAATGGCAATCCAATTAAGGATTTGACATAA
AAGAAGCTCAACAATTTAAAGAAATGCATTGGAAAGTAAGCCAAGAATTCTTTATAGTAA
AACTGCAGTAAAGCAGTTCAAAACTCATTGGATTAGTTAATGAGCCCAATGGCACTGGTA
GATGAAAATTAATAGCAAAATGGCAACAATATACCTATGGAAGTAGATCATCCTAATCCA
CCTGGGAGTGATAATTTGCTCGATTCTGACATGAAAAAGCGACTTTTGGATATATAGCTG
CAGAAAGAGCTACTTCAATAATAACAACAAAAGATTCAAGAGTAGGAGCTACTGATGATG
CAGCTCTTCGAGTAACAACAAGAGCAAGAGAGATAAAAACGACTGTAGATACAGCAACAG
TAATAACAGCAGATCAAAGAGCAGTAAGAACGGATTCAAAGAGAGATCTTGAAGAATAAC
AATCAATCAGAAAATAATCAACAGCAATAATAACACTAACAGTAGTAAACTAGTTCAATA
AATAACTTTAACAATGCGACCTTTAATTCTTCAATACCTGAAAACACAAGCAGTTGCTTA
AATTAACAGTAGCAGCCTCTCACCATTCAAGATCCTATTCAGGCTTCATCAGAAAACTAA
GCAAATGAAAAGAAGTTTATGGGTAAAAAGAGAGCAATAAGGAAAATGGGAAGTCTCTCT
CAGGCGCTGGCTTCTTAACAAACCACGAATGTTTAGCAGCAAGTTGGCTTTGGTAATCTG
TAGCATTAACAACAGCAAACTGATTTGATATCTGTAACCCCAGTCAACTCAAGCAATAAT
ATACAAGCATATTAGCAAAAGCAGCCTCAACAGGAAATTGAGGAAATCAAAGATGATCAA
CCCATATAGCAATAACAAGTTGCGACAACGATTATAGCTGAATGTAAGGGGTCATTCGAA
ACAGATATTCCAGAGAGGGTATATAGTGCAAAAATGTCTAAACATTGTATTGAAGTTACA
ATTGAATGGCAAGTGAGAGCAGATGGAGTCAAGCCTCTCCCCACTCAATATTCAAACAAC
GAGGTGAAAGAGAGATGTCCAAAGTTGCTGGTTGACTTTTATGAGAGCAGGATAAATGCA
AGATCAAGGGGTGGTTCATCGCAGGGAGCAGCATAAACAATTAACACTAATTGA


>Contig19010.0.g64(protein)
MVKKTSARLQSNGGPILGYANQDDYLDEIIGDASIKEAKRQKMPGKVAQQKPGSGVPGGV
ENDSSSEDDNFFAVERIIDKRQKGKRVQYLVKWENYGEEANTWEPVSNLRNVKDLIVEFE
KKIEMQVNINNQSSSTCISNHAAISSGQGDMQMQNVSGQTSENTKNNNANNKYGTSLNSK
VIKKQIKLKENGNPIKDLTQKKLNNLKKCIGKQAKNSLQQNCSKAVQNSLDQLMSPMALV
DENQQQNGNNIPMEVDHPNPPGSDNLLDSDMKKRLLDIQLQKELLQQQQQKIQEQELLMM
QLFEQQQEQERQKRLQIQQQQQQQIKEQQERIQREILKNNNQSENNQQQQQHQQQQTSSI
NNFNNATFNSSIPENTSSCLNQQQQPLTIQDPIQASSENQANEKKFMGKKRAIRKMGSLS
QALASQQTTNVQQQVGFGNLQHQQQQTDLISVTPVNSSNNIQAYQQKQPQQEIEEIKDDQ
PIQQQQVATTIIAECKGSFETDIPERVYSAKMSKHCIEVTIEWQVRADGVKPLPTQYSNN
EVKERCPKLLVDFYESRINARSRGGSSQGAAQTINTN