Identifiers and Description

Gene Model Identifier

Contig18964.0.g30

Standard Name

None

Aliases

Contig18964_0_g30

Description

Nucleoside transporter

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002211509.9981864321491e-40Nucleoside transporter family
protein
SGDYAL022C2.9992476920535046e-16FUN26 SGDID:S000000020, Chr I
from 110430-108877, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18964.0.g30(coding)
ATGACGAAAGGAAGTACTCTCGAAAGTAAAGACATGAGATTTGACACAGATAACACAAAG
TATTCTCAAGAAATCCCTCAAATTAAGGAACCAGAAGATAAGGGAGGCATCGCATACCTA
CTCATGGTACTGTTTGGTATTGGAGCTCTCTTGCCTTGGAATGCCATCTTAACCGCACTT
GATTTCTTTAAGGAAAAGTTACCTGGTTATCAACCAGATTTCGTGTTCAGTCTTGCAAAC
AATGGTCTCTTGACAGTAATTTAGTTATTCATTGTCATTCAAGGCCACAAGTATGGCTAT
GTACTTAGAATTTCTGGTGGATTCTTAGTTATATCAGTCCTAATGATTGGTCTTCCACTC
TCAGCCAACTTCCTTAATCCAGATGCTGGATTTGCTGCCTGTATCTCTATCCTCGTTGTC
TTTGGAGCAATGGGAGGTATTGTATAAGGTAGTGTATTTGGATTAGCAGGCATGTTCCCA
TTCAAATATATGGGAGCTGTTATGTTCGGTAATGGGCTTAGTGGAATCACTTTAAACATC
CTTAGAGCTATCACTTTAGCTGCACTTCCTCCTATTACAGGCTCAGATAACAACTTCAAA
GGATCACTCATCTATTTTATCTTAGCCTCAGTTATTTTGATAATTTGTGCAATCGGTATG
GTGTTCTTCATGAAGATGAATTTTGTTATCTATTACGTCAAAAAAGCAAGTGACGAGAAA
AATAAAACTGTTCGCAGAATCAGTGGAATTAGAGAGGATATGGATGAAGCTGACAGATCA
CTTTTGAGCAGTGCTGATATAAACAAAACTGCTGACTTATCACAAAAGAACTTGAAAGTT
GACCACAATAGTCACGTACAATAGCCAACTCATTCAGCTTTCGTTGCCTTCATGATTATG
CTTAAGAGAAGTTTTATCTACGCTTGGTAATTCCTTACAGCAATCACTTCAGTCTTTGTT
ATAACTTTTGTTGTATTCCCAGGAGTCTCTCTACACACTGGCCTCGCATTCATGTCAGGC
ATCACAGACCCAGGCCTAAGAGGTGCATGGACTGCTCTCATTTTCATTATTCTCTTCAAT
GTTTTCGATACTATTGGAAGATGGCTTGCAGGACAAAGTTTCGGTTAAGCTCCAGATAAA
CTTGTAATTATATTGGTATACTCTAGAGCTATATTCATAGTAACTTTTGTGCTTATTTCA
CTTGATCAGCCACCCATGTGGTTGTTCGGTGACAATGCTGACTGGTTCAAGGTTATCAAT
ATGATTCTTTTCGCATTCTCTAATGGTTATTGCAGTACTTAATGCGCTATCAAAGCTCCA
TCAAGAGCTCCAGATGATTCAAAGGAACAAGTTGGTACATTGATTGGTCTTTTCTTAACA
ATTGGTATCTTCCTTGGTTCTTTAATTGCACTAGGCATGGGTAAAATGTTCCACGATTAA
TGA


>Contig18964.0.g30(protein)
MTKGSTLESKDMRFDTDNTKYSQEIPQIKEPEDKGGIAYLLMVLFGIGALLPWNAILTAL
DFFKEKLPGYQPDFVFSLANNGLLTVIQLFIVIQGHKYGYVLRISGGFLVISVLMIGLPL
SANFLNPDAGFAACISILVVFGAMGGIVQGSVFGLAGMFPFKYMGAVMFGNGLSGITLNI
LRAITLAALPPITGSDNNFKGSLIYFILASVILIICAIGMVFFMKMNFVIYYVKKASDEK
NKTVRRISGIREDMDEADRSLLSSADINKTADLSQKNLKVDHNSHVQQPTHSAFVAFMIM
LKRSFIYAWQFLTAITSVFVITFVVFPGVSLHTGLAFMSGITDPGLRGAWTALIFIILFN
VFDTIGRWLAGQSFGQAPDKLVIILVYSRAIFIVTFVLISLDQPPMWLFGDNADWFKVIN
MILFAFSNGYCSTQCAIKAPSRAPDDSKEQVGTLIGLFLTIGIFLGSLIALGMGKMFHDQ