Identifiers and Description

Gene Model Identifier

Contig18962.0.g37

Standard Name

None

Aliases

Contig18962_0_g37

Description

von Willebrand factor type A domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004718301.999576471039937e-58Ubiquitin interaction motif fa
mily protein
SGDYHR200W1.0000844672813518e-48RPN10 SGDID:S000001243, Chr VI
II from 499079-499885, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18962.0.g37(coding)
ATGGTTCTTGAGGCAGTCGTTGTTTGTTTGGACAACTCCGAGTGGAGTAGAAACGGAGAC
TTTGCACCATCTAGATGGGACAGCTAGATTGATGCTGCTAACATCATTTGCGAAGCTAAG
ACTCAATAAAATCCAGAGAATACTCTTGGCATAATGGCTTATGCAGGAAGAAGAGTTGAC
ATTAAATTGACTCAGAGTAATGACATTGGATTGTTGCTTAATGCCATCAACTCAATTGAA
ATCAACGGTCAAGCTGATTTCTTCAATGCAGTTAAGATTTCCCAACTCAGTTTGAAGCAC
AGACAAAACAAGTCACAGAGACAAAGAATCATTCTCTTTATTGGCCATCCATTGAAAGAA
GATGAGGAGCAATTTGAAGAACTAGGCATTAGAATGAAGAGAAACAACGTAGCCTTGGAT
GTCATTAACTTTGCTCACCCAGAGAATGTACCCAAGCTACAAACTTTAATCAGAGCAGCT
GACAACAATAGAAATTGCCATTTCCTAGATGTCCCACTTGGTGTTGCAATGATTACAGAT
GTGCTTATTGCTTCTCCAATCATTAACCAAGAGGAAGAAGGAGCACCTAACATGGGTGCA
GCAGGTGCAGGTGCTGGAGCTGGCATTGGCGGAGGAGCTCCAGTAGCTTCTTAATTTGCT
GAGTACGGTGGAATTGATCCAAACCTTGACCCAGAGCTTGCTATGGCACTCAGAATCTCA
CTTGAAGAGGAAAGAGCTCGCCAAGTATAACCTGGTGATGAGCAGCCTGCAGATGCCTAA
GCTCAGTAGTAAGTAGCAGGTGCCGATTAAGCCATGGCAGATGTGGGTGACGATGAAGAA
ATGGACGAAGAAGCAATCCTTGCTCAAGCTAAATTGCTCTCAATGCAAGAAAGCCAGTAA
CAACAATAACAGCAACCAGGTGCAGCAGGATTGGGTCAATCCTAATTCGCTGATTTGATT
AACAATGAATTTGTGGGCCAATTAGTTGCGGATCTTAACTTAGACTTGGACAATAACGAT
CTTGACTCATTGATCAACTAGATTGGTGCTTAACCCAAGAAGAATGATGAAGAGCAAAAG
AAAAAAGAAGAGGAAGATAAGAAGCAGGAATGA


>Contig18962.0.g37(protein)
MVLEAVVVCLDNSEWSRNGDFAPSRWDSQIDAANIICEAKTQQNPENTLGIMAYAGRRVD
IKLTQSNDIGLLLNAINSIEINGQADFFNAVKISQLSLKHRQNKSQRQRIILFIGHPLKE
DEEQFEELGIRMKRNNVALDVINFAHPENVPKLQTLIRAADNNRNCHFLDVPLGVAMITD
VLIASPIINQEEEGAPNMGAAGAGAGAGIGGGAPVASQFAEYGGIDPNLDPELAMALRIS
LEEERARQVQPGDEQPADAQAQQQVAGADQAMADVGDDEEMDEEAILAQAKLLSMQESQQ
QQQQQPGAAGLGQSQFADLINNEFVGQLVADLNLDLDNNDLDSLINQIGAQPKKNDEEQK
KKEEEDKKQE