Identifiers and Description

Gene Model Identifier

Contig18924.0.g31

Standard Name

None

Aliases

Contig18924_0_g31

Description

Cleft lip and palate transmembrane protein 1 (CLPTM1)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam05602 ) Cleft lip and palate transmembrane protein 1 (CLPTM1)
  • ( pfam04193 ) PQ loop repeat
  • ( pfam06496 ) Protein of unknown function (DUF1097)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000160503.0008725323024365e-87Cleft lip and palate transmemb
rane protein 1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18924.0.g31(coding)
ATGTAGTAAGCAGCTAATCCCCAAGGTAACTAGGGATAAGGAGAGCAGCCAGCTGAAGGG
CGAGGCTCATTTATTCAAGAAATGTGTCGAATGATGGCAATGATGATGCTAATGCAAACA
GTTGTTTAGTATTTCTTCACTGGCAATCCTTCTAAGGAGCAATTAGTAGAGTTTGATCCA
CTCTTAGGAAATTTATCAGCTGACAACATGACAAGACCATCAATGAGTATTTCAAATAAT
GGAGGTTTTTAGAATATAATGAGACATCACGATAAATTTGACTTTGACGTCTACTTAAGT
TTTCACAATCCCTATGCATTTTTCTAGAGGGAACGCATCAATGAAAAGCAGCCAATTTGG
AGCGAGAAAGATTTATACTATGAATACGCTGAAGCAAATGATAAGCATTTGAATGTAACA
ATTCCTGTGAATGAATATCTTCGCAAAAACCTTACTCTATTCTTACACATGCAAATGACT
ACGAGAAACCCATTTTATATCAAAGGAGTGAACGATAAGGACTATGGTGATATCGGAGGG
TATCAGGATATTCATGGAGAAATAACAACTAATGAATAATTACAGAGAAGAATTAGAGCA
AAGGTATAACCAGAATTTCTCAAATTTAATCAGAGTATACCATTGATAAAATACATGCCT
AAGATTAAAGATAAGGTTGTCAGAAACTTACTTGATGATAATCCAGTTCCATTAAAAGAG
AAGCAAGATCCTGAGGAGGAAGAGGATAAAACTTATTATTAATACTTTAAGAAGGAACTT
TACCTATACGTAATTTTGGATCAATAAGTTTACAATCCTAGTAGTTTACCACCTCCAATT
GCTAAAAACATAAAATTTGATTATGAATCAAATACATATCAACCAATCATGTATTTGAGT
GATTATTGGCTATTAAAGAAGGACTTGATAATGGTGAACGATACTGTAAATGAATTGAAT
TTAACCCTTCACTTCAACACATTCTCTCAAAACTACTTTATCATTCAAAAATAGTTTGAA
GAATAGCATGATAAATAGAAGGAGTGGGGTATTGAAAGTGCAGATATGGATGAAATGAAG
AGAATGTTTCTCGAAACTGATCCCATTCTATTATCAGTAACAATTTTAGTGTCTCTTTTA
CATACTGTTTTCGAAGTTTTGGCTTTCAAGAACGATATTAATTTCTGGTAGAACAAGGAT
TCAATGGAGGGCATTTCTGTCAAGACTTTATATTTATAAACTGGTTGCTCTATAATAATC
TTCTTTTACTTGTTTGACAATGAAACTTCCTTTATGATTTTAGCTTCAAATGGTTTTGGA
ATTTTACTAGACTTCTGGAAAATCAAGAAAGCTTCCAAGTTTATTAGAAAAGATAAATTC
CCCTACTTTATATTGGAAGATAAGGATTCTTATTCTTAAAGTGAGACTAAGGAATACGAT
AGAATTGCAATGAGATACATGTCTTATGCACTAGGCCCTATGATGGTTGGCTACACTGTG
TATTCTGTTATGTATAATGAACACAAGGGTTGGTACTCTTTCATCTTGAACACTTTAGTA
GGCTGCATCTACACATTTGGTTTTATTCAAATGACGCCTTAGCTGTACATCAACTATAGA
TTGAAAAGTGTGGAGCACATGCCTTCAAAAGCATTGTTCTATAGGTTCTTAAACACAATC
ATTGATGATTTATTCAGTTTCATTATTACTATGCCAACACTTCATAGACTTAGTTGCTTC
AGAGATGATGTAATCTTCCTAATTTACATTTATCAGAGATGGATCTACAAAGTAGATAAG
ACTAGAGGGCCCTGGGCTGATTAGAAAGCAAGAAAAGAAGAGGAAGAAAAGCAAAAACAA
CTAGAACAGGAATAGTTACAGAATAAGCCAATTGAGGAAGGTAAATAAGAAGAGGCTAGC
AGAAAATAAGTTGATGGAAGCAAGAAAAATAAAGTTTTTATAGTGGATGAAGATGACTAA
TCAATTGATACTCAAGTCAATGAGGAAAATAAAGCATCGAATGATAAATAAAAGACAGAA
TGA


>Contig18924.0.g31(protein)
MQQAANPQGNQGQGEQPAEGRGSFIQEMCRMMAMMMLMQTVVQYFFTGNPSKEQLVEFDP
LLGNLSADNMTRPSMSISNNGGFQNIMRHHDKFDFDVYLSFHNPYAFFQRERINEKQPIW
SEKDLYYEYAEANDKHLNVTIPVNEYLRKNLTLFLHMQMTTRNPFYIKGVNDKDYGDIGG
YQDIHGEITTNEQLQRRIRAKVQPEFLKFNQSIPLIKYMPKIKDKVVRNLLDDNPVPLKE
KQDPEEEEDKTYYQYFKKELYLYVILDQQVYNPSSLPPPIAKNIKFDYESNTYQPIMYLS
DYWLLKKDLIMVNDTVNELNLTLHFNTFSQNYFIIQKQFEEQHDKQKEWGIESADMDEMK
RMFLETDPILLSVTILVSLLHTVFEVLAFKNDINFWQNKDSMEGISVKTLYLQTGCSIII
FFYLFDNETSFMILASNGFGILLDFWKIKKASKFIRKDKFPYFILEDKDSYSQSETKEYD
RIAMRYMSYALGPMMVGYTVYSVMYNEHKGWYSFILNTLVGCIYTFGFIQMTPQLYINYR
LKSVEHMPSKALFYRFLNTIIDDLFSFIITMPTLHRLSCFRDDVIFLIYIYQRWIYKVDK
TRGPWADQKARKEEEEKQKQLEQEQLQNKPIEEGKQEEASRKQVDGSKKNKVFIVDEDDQ
SIDTQVNEENKASNDKQKTE