Identifiers and Description

Gene Model Identifier

Contig18830.0.g95

Standard Name

None

Aliases

Contig18830_0_g95

Description

FKBP-type peptidyl-prolyl cis-trans isomerase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

  • ( pfam00254 ) FKBP-type peptidyl-prolyl cis-trans isomerase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002270602.0008536325002377e-42FKBP12 binding protein
SGDYNL135C3.998395524589391e-34FPR1 SGDID:S000005079, Chr XIV
from 372226-371882, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18830.0.g95(coding)
ATGGGAGTCTCAATTGAAACATTAGTGCTGGGTGATGGTCAAAATTTCCCAAAGCGTGGA
AACACACTAATAGTACACTACACAGGTCGCTTGGAGGATGGTTCAAAATTTGATTCTTCG
AGAGATAGAAATGAACCTTTTGAATTTGTGCTGGGCGCAGGACAAGTAATCAGGGGTTGG
GAAGAGGGACTCGCTCAAATGAGCAAGGGATAAGTTGTTAAGTTAACATGTACCCCAGAA
TATGCGTATGGTCAGTAAGGATTCCCACCTATTATTCCAGGAAATGCAACTTTGACTTTC
GAAGTAGAATTAATAGACTTTAAGTGA


>Contig18830.0.g95(protein)
MGVSIETLVLGDGQNFPKRGNTLIVHYTGRLEDGSKFDSSRDRNEPFEFVLGAGQVIRGW
EEGLAQMSKGQVVKLTCTPEYAYGQQGFPPIIPGNATLTFEVELIDFK