Identifiers and Description

Gene Model Identifier

Contig18685.0.g30

Standard Name

None

Aliases

Contig18685_0_g30

Description

Hsp70 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001051109.997093137033517e-262dnaK protein
SGDYBL075C9.997093137033517e-262SSA3 SGDID:S000000171, Chr II
from 86448-84499, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18685.0.g30(coding)
ATGTCAACAGGACCCGCTATTGGAATAGATCTCGGCACCACTTACTCTTGCGTAGGTGTG
TGGCTCAACGACAAAGTTGAAATCATCCCCAACGATCAAGGAAACAACACCACTCCATCA
TACGTCGCTTTCACTGAAGAAGAGAGACTTATTGGAGACTCAGCCAAGAATCAAGTTGCT
AGAAACCCCAAGAACACCGTCTTCGACGCCAAGAGACTTATCGGAAGAAAATTCTCTGAG
AAGCAAATTCAAGACGACATGAAGCATTGGCCATTCAAGGTCGAGCAAGGACCAGCTGAC
AAGCCAGTCATTGTTGTCGACTACAAGGGTGAAGCCAAGAAGTTCCACGCTGAAGAAATC
TCATCTATGGTCTTGATCAAGATGAAGGAAATCGCTGAAGCTTATCTTTCAAAGACTGTC
AAGAACGCTGTTATCACTGTCCCAGCTTATTTCAACGACTCACAGAGACAAGCCACCAAG
GATGCTGGTACCATCTCAGGTATGAACGTTCTCAGAATCATCAACGAGCCAACTGCTGCC
GCTATTGCTTACGGTTTGGACAAGAAATCATCCCAAGAGAAAAACGTTCTCATCTTCGAT
CTCGGTGGTGGTACTTTCGATGTCTCCCTCCTCACCATTGAAGAAGGTATCTTCGAAGTT
AAGGCCACCAACGGTCACACCCATTTGGGAGGTGAAGATTTCGACAACAGACTTGTCGAC
TATTGCGTTGCTGAATTCAAGAAGAAGACTGGTATTGACATCAACGGAAACGCCAGAGCA
CTCAGAAGACTCAGAACTCAATGCGAGAAGGCAAAGAGAATTCTTTCAGCTGCCCATCAA
GCCCCAATTGAATGCGAAACTCTTGCTGAGGGTGAAGACTTCAACACTCAAATCTCAAGA
GCTAAGTTCGAGGAACTCTGTATGGATCTCTTCAGAAAATGTATGCCACCCGTAGAAAAC
GTCCTTAAGGACTCAGGCCTCGCCAAGGGACAAATCCACGAAGTTGTCTTGGTTGGTGGT
TCAACCAGAATCCCCAAGGTTCAACAAATGCTCTCCGACTTCTTCAACGGAAAGACCCTT
AACAGATCAATCAACCCAGATGAAGCTGTTGCTTACGGTGCTGCCGTCCAAGCTGCTATT
CTCACTGGAGAAGGAGACAGCAACGTCAAGGATCTCCTCCTTTTGGATGTTACCCCACTC
TCAACCGGTATTGAAACTGCTGGAGGTGTCATGACTGTTCTCATTCCAAGAAACACTACC
ATCCCAACCAAGAAGTCACAAATCTTCACCACCTATGCTGACAACCAACCAGGTGTCTTG
ATTCAAGTCTTCGAAGGTGAAAGATCAATGACCAAGGATAACCACTTACTCGGTAAATTC
AACCTTGAAGGTATCCCACCCGCTCCCAGAGGTGTCCCACAAATCGAAGTCACTTTCGAT
ATTGATGCCAACGGAATCTTGAACGTCTCAGCCGTCGACAAGGGAACTGGTAAAGTTAAC
AAGATTACCATTACCAACGACAAGGGTAGACTCAGCAAAGAGGAAATCGAAAAGATGGTC
AGTGAAGCTGAGAAATACAAAGGCGAGGATGAGAAGATGAAGCTCAGAATCGAAGCTAAG
AACAGTTTCGAAAACTACTGCTTCCAAATGAGAAACACCCTCAATGACGAGAAACTCAAG
GAGAAGTTCACTGAAGATGACAAGAAGGTTATCGAAGATGCCTCCAAGGAGGGTCTCCAA
TGGCTTGAAGGCAACGCAATGGCCGAGCCAGAGGAAATCGAAGCCAAGCAAAAGGAAATT
GAGGCTAAGTACAACCCAATCATGATGAGAGTCTACCAAGCTGCTGGTGGTGCTCCAGGT
GGAATGCCAGGTATGCCAGGTTTCCCAGGTGGTGCCCCAGGTGCTGGTACTGCTCCAGGT
GGAGGCGATGTCAACGACCTCGACTGA


>Contig18685.0.g30(protein)
MSTGPAIGIDLGTTYSCVGVWLNDKVEIIPNDQGNNTTPSYVAFTEEERLIGDSAKNQVA
RNPKNTVFDAKRLIGRKFSEKQIQDDMKHWPFKVEQGPADKPVIVVDYKGEAKKFHAEEI
SSMVLIKMKEIAEAYLSKTVKNAVITVPAYFNDSQRQATKDAGTISGMNVLRIINEPTAA
AIAYGLDKKSSQEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATNGHTHLGGEDFDNRLVD
YCVAEFKKKTGIDINGNARALRRLRTQCEKAKRILSAAHQAPIECETLAEGEDFNTQISR
AKFEELCMDLFRKCMPPVENVLKDSGLAKGQIHEVVLVGGSTRIPKVQQMLSDFFNGKTL
NRSINPDEAVAYGAAVQAAILTGEGDSNVKDLLLLDVTPLSTGIETAGGVMTVLIPRNTT
IPTKKSQIFTTYADNQPGVLIQVFEGERSMTKDNHLLGKFNLEGIPPAPRGVPQIEVTFD
IDANGILNVSAVDKGTGKVNKITITNDKGRLSKEEIEKMVSEAEKYKGEDEKMKLRIEAK
NSFENYCFQMRNTLNDEKLKEKFTEDDKKVIEDASKEGLQWLEGNAMAEPEEIEAKQKEI
EAKYNPIMMRVYQAAGGAPGGMPGMPGFPGGAPGAGTAPGGGDVNDLD