Identifiers and Description

Gene Model Identifier

Contig18641.0.g69

Standard Name

None

Aliases

Contig18641_0_g69

Description

Tetratricopeptide repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • regulation of mitotic metaphase/anaphase transition (IEA) | GO:0030071

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007364706.002196208547375e-166Anaphase promoting complex sub
unit 8 / cdc23 ...
SGDYHR166C1.99927841627239e-68CDC23 SGDID:S000001209, Chr VI
II from 439050-437170, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18641.0.g69(coding)
ATGTGGAACTAAAACGCAGCAGCTACAGGGGGAAATCATAATTTGCATTAAAACATGACC
CAAAACAATTAAAATATGAATGCTAACTAATAAACCCCAGCTCAGGGAGTTTTTGATTTT
GTGTTTCGAGATGAATTTCAAGTTATTGTTCAATTCCCAGATAGAAATTCTTTAGCAAGA
GAGATTAGATATCACATGAACTACTTCTAGTAAAATAGATTGCTACAATCCACTAAATGG
TTGGGAGAATTATTGTTGACAATCACTAACCACTAAAATAGTTAAGTTTATGGCACTTTC
AACATAGGAGAAGATCATTATTAGCAGTAAAATCAGCATCACAATTAAAACTTCTAGTCA
AGCCAAAATTCTTAAGATATTTAAATGTCTAGTTCAAATAGCATTGGAGGTGTGAGTCCT
GGCTTCCCTGGTACATCTCCTAACCCACAAATGAACCAATCAACTTAATTGAAGTTTACA
GATAGAGGTGATATACCAGAGTAGCAACTTTACTCGCCAGAGTAGCCTTTTAATAAAGTC
TACTATGAGCACCAATCAGAGATTACAGATGTATTGAATTTAGCGAGATCACTTTTTGAC
TTAAGAGAATATAGAAAATGCTCTCATTTATTGAAGCCATTCGCTAACTATAAAAATCAA
AGTGCTCTCTTCTTACATTATTTCGCCCTCTATTAAGTCAGTGAGATGACTAAGGAGGAA
GAAATCTTGTAAAGTGGTGATAAAATTTCATGTTCCATGGTGCAGAACAAAGAATTGGCT
TTAATCGAGACTGAGTTGCAATAACTCTATGAAAAAGATCTACTCAATGGCATTAATTTA
TACCTTTACGGAGTCATACTCAGAGAAAAGAACAAAAAGGAAGAGGCAAAGCAAGTATAA
ATCCAGGCCTTGAACAAAATGCCACTTCTTTGGTCAGCCTGGCTTGAACTGGGTTCATTG
ATTAATTAAACTGACAGGAAGGTGTTCTAGAAACTCAAAGAGCACTGGATGAACAATTTC
TACTTCGCAAATTTCTTCCTGGATATTTAACAAGATAATGATTCTCATGCATCTTACACA
TCTCAGGAATATGATGTCTCCCTGGACTGGTTCTCAAAATTAATATAAGTTGACCCCTAT
CGCTATGAAAACATGGACCTCTACTCCAATATCCTCTATATCAAGGAGAACTTTGGAGAA
TTGGCCCATTTAGCTTTCAAAGTATTCCACAATGATAAATACAGACCAGAGTCTTGTTGT
GTAATTGGTAATTACTACTCACTCCGTGGAGACCACCAAAAGGCAGTGATTTACTTCAAG
AGAGCAGTGAAATTAGACAATAAATTCTTGTCTGCGTGGACACTGATGGGCCATGAATAC
CTTGAGATGAAGAATACGAATGCTGCCATAGAGAGCTACAGGACTGCAGTTGATATTGAT
GCGAAGGATTTCAGGGCTTGGTATGGTCTGGGGTAGACTTATGAGATCAATTAAATGTAC
AACTATGCTTCACATTACTATGCTAATGCTGCCTTATCTAAACCACAGGACTCTCGTATG
TGGATAGCCATGGGAGGGTGTTACGAGAAAATGGACAGAAAGGAAGAGGCGGCAAAGTGT
CATGAGAAGGGAGAGAGATTCAAGGACAAGGAGGGTATTGCACTTCACAAATTAGCAAAG
CTATATATCCAAATGGGTGAGCATGAAAAAGCAGCAAACTGCTTCTAAATTAACTTGAAA
AGAAAAGATCTTGAAGAAATCGAGAGTAGCGAAACTACAGAAGCGCTGATGTACCTGGCA
AAATACTACAAAAGTATGGAGAGATACGAGGAAGCCATTGCCTTTGCTAGAAGACTGCAT
GATTACAGTGGCACAGAGAGAGAAGAGGCCAGTGCCCTCATTAGAGAGATCAATCAACTC
GCATAGTTCCAACATAGTCAAGGACCTAATGTTAACAATCACAATCAAGGTAACATCCAC
ATGCAGCATCATTGA


>Contig18641.0.g69(protein)
MWNQNAAATGGNHNLHQNMTQNNQNMNANQQTPAQGVFDFVFRDEFQVIVQFPDRNSLAR
EIRYHMNYFQQNRLLQSTKWLGELLLTITNHQNSQVYGTFNIGEDHYQQQNQHHNQNFQS
SQNSQDIQMSSSNSIGGVSPGFPGTSPNPQMNQSTQLKFTDRGDIPEQQLYSPEQPFNKV
YYEHQSEITDVLNLARSLFDLREYRKCSHLLKPFANYKNQSALFLHYFALYQVSEMTKEE
EILQSGDKISCSMVQNKELALIETELQQLYEKDLLNGINLYLYGVILREKNKKEEAKQVQ
IQALNKMPLLWSAWLELGSLINQTDRKVFQKLKEHWMNNFYFANFFLDIQQDNDSHASYT
SQEYDVSLDWFSKLIQVDPYRYENMDLYSNILYIKENFGELAHLAFKVFHNDKYRPESCC
VIGNYYSLRGDHQKAVIYFKRAVKLDNKFLSAWTLMGHEYLEMKNTNAAIESYRTAVDID
AKDFRAWYGLGQTYEINQMYNYASHYYANAALSKPQDSRMWIAMGGCYEKMDRKEEAAKC
HEKGERFKDKEGIALHKLAKLYIQMGEHEKAANCFQINLKRKDLEEIESSETTEALMYLA
KYYKSMERYEEAIAFARRLHDYSGTEREEASALIREINQLAQFQHSQGPNVNNHNQGNIH
MQHH