Identifiers and Description

Gene Model Identifier

Contig18550.0.g55

Standard Name

None

Aliases

Contig18550_0_g55

Description

ATP synthase (F/14-kDa) subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178

Molecular Function

  • proton-transporting ATPase activity, rotational mechanism (IEA) | GO:0046961
  • proton-transporting ATP synthase activity, rotational mechanism (IEA) | GO:0046933

Biological Process

Domains

  • ( pfam01990 ) ATP synthase (F/14-kDa) subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000470701.000137892321693e-31V-type ATPase, F subunit famil
y protein
SGDYGR020C1.0002869940498747e-21VMA7 SGDID:S000003252, Chr VII
from 527329-526973, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18550.0.g55(coding)
ATGTCAAAGAAGGGAAAGGCTTTCCGTGTGAAGGGTTCACTCTTAGTTGCAGTCATTGGT
GATGAACCAACTGTAACTGGATTCTTGCTAACTGGCATCGGTGAACGTAACAGAAAGGGT
GACGCTAACTTCTTGATTGTGACCAAGGACACCACCCTCACTCAAATTGAAATCTTCTTC
AAGAAACTGATCGACAGAGACGACATTGGCATCATCATGATCTCTCAGAACATCGCAGAG
ATGATTAGAAATCTGATTACGGAGCACTAGGAGGTCATACCCACAGTCATGGAAATACCA
TCTAAGGATGTTGCTTACGACCCAGAAAAGGATATGATCTTGAACAGAGCTGCCAGAATC
CTCTATGGTAACGAAGTCGGCATGGAGAAGCTCAGACAGCAAGATTGA


>Contig18550.0.g55(protein)
MSKKGKAFRVKGSLLVAVIGDEPTVTGFLLTGIGERNRKGDANFLIVTKDTTLTQIEIFF
KKLIDRDDIGIIMISQNIAEMIRNLITEHQEVIPTVMEIPSKDVAYDPEKDMILNRAARI
LYGNEVGMEKLRQQD