Identifiers and Description

Gene Model Identifier

Contig18515.0.g30

Standard Name

None

Aliases

Contig18515_0_g30

Description

NAD binding domain of 6-phosphogluconate dehydrogenase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam03446 ) NAD binding domain of 6-phosphogluconate dehydrogenase
  • ( pfam02826 ) D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
  • ( pfam03807 ) NADP oxidoreductase coenzyme F420-dependent
  • ( pfam02737 ) 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
  • ( pfam03721 ) UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain
  • ( pfam01262 ) Alanine dehydrogenase/PNT, C-terminal domain
  • ( pfam10727 ) Rossmann-like domain
  • ( pfam01408 ) Oxidoreductase family, NAD-binding Rossmann fold
  • ( pfam13460 ) NADH(P)-binding
  • ( pfam02254 ) TrkA-N domain
  • ( pfam07991 ) Acetohydroxy acid isomeroreductase, catalytic domain
  • ( pfam00670 ) S-adenosyl-L-homocysteine hydrolase, NAD binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011238409.000840820639671e-863-hydroxyisobutyrate dehydroge
nase family pro...
SGDYGR256W0.000030009396760408108GND2 SGDID:S000003488, Chr VII
from 1004624-1006102, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18515.0.g30(coding)
ATGATACTTAAATTCTTGGGTGTAAGACGCTTTTCCACAGCTGCTACAAGCGAATTCGGA
AAGAGAGTTGGTTTTATTGGATTGGGAAATATGGGACTTCCCATGACTGCAAACCTCGTA
CAGAGAGGCTTCTAAGTTAAAGCTTTCGATTTAAATCCAGCTACTCTCGAGAAGTGTGCT
GAAGTTGGTGTTAAGGCAGTAAAAACAGTTGGAGAAACTGCTTCAGATGTTGATTACATT
GTGACAAGTGTTCCAGGAACAAAAGACGTTGAAGAGCTATTGAAGGGGCCAGACGGAATT
TTCAAGAATGCAAGAAAAGGGACTATGATTTGCGATACCAGCACTATTTCGCCAATTGCA
TCTAAAGAATTTGCAGCTGAAGCTAAGAAGAAGGAGTTTATATTTGTAGACTCCCCTATG
TCAGGTGGTATCACTGGTGCTCAAGCTGGTACCTTGACCTTTATGGTTGGATGCGAGAAA
GACCACTTTGAATAAGCAAAGAATGTTCTTCTAGGTATGGGTAAGAACGTATTTCACTGT
GGAGGTCCAGGCACAGGAGAAGTTGCTAAGATTTGCAATAACTTGATTCTTGGTATAAAC
ATGATTGCCCTAGCAGAAGGTATGTCTCTCGGTGAGAAACTAGGAATTGACCCCAAAGTT
CTCTCAAACATTCTTTCAGTAAGCACTGCAAGATCTTGGTGTGTTGATACCTACAACCCC
AGACCAGGTGTTCTCGAAAACGTTCCAGCAAGCAGAAACTATAATGGAGGGTTCCAAGTC
AGTCTAATTAGAAAGGATCTAAGTATCGCACTTGAAGCTGCCGAGCAAACTGAGGCAGCT
ACAAAATTCGCTGAACATGCCATCAACTACTATAGAGAACTTGAGAAGAAAGGATTTGGC
AAGAAAGATTTTGGATATGTTTATCAATACATTCACAAGAACTTTGAAGTATGA


>Contig18515.0.g30(protein)
MILKFLGVRRFSTAATSEFGKRVGFIGLGNMGLPMTANLVQRGFQVKAFDLNPATLEKCA
EVGVKAVKTVGETASDVDYIVTSVPGTKDVEELLKGPDGIFKNARKGTMICDTSTISPIA
SKEFAAEAKKKEFIFVDSPMSGGITGAQAGTLTFMVGCEKDHFEQAKNVLLGMGKNVFHC
GGPGTGEVAKICNNLILGINMIALAEGMSLGEKLGIDPKVLSNILSVSTARSWCVDTYNP
RPGVLENVPASRNYNGGFQVSLIRKDLSIALEAAEQTEAATKFAEHAINYYRELEKKGFG
KKDFGYVYQYIHKNFEV