Identifiers and Description

Gene Model Identifier

Contig18492.0.g71

Standard Name

None

Aliases

Contig18492_0_g71

Description

Fatty acid hydroxylase superfamily

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam04116 ) Fatty acid hydroxylase superfamily

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003482303.001032840497736e-70Sterol desaturase family prote
in
SGDYGR060W3.99801309251602e-27ERG25 SGDID:S000003292, Chr VI
I from 610564-611493, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18492.0.g71(coding)
ATGTCATAATAAACTAAGCAATCATCAAGTAGCTCTTAAGATAAAAAGCTTCGTGCCACT
AAAGAGACAGTAACAGTTTAAAAAGTAATAGATAGAGAGATTTAAAGATATTAACGAAGA
GGAAAAACAGGAATCATTTTGGCTTTTATACAAATAGCATTTTTACTCTGGATAGTACCA
CAAATGGGATAAATCTTCTGGCCAAAGCTTTTGGACCTGATGAAAATCTATAATTTAGAA
AAATGGCAAATATCTTTTATTAATTCGTTTGGATGGAGTGCAATCTCATACTTTCTCTAT
AACTTCATATTCTGGATAATTTACCACTTAGAACTACCCTTCTTCGAGTAGTTTAAGATT
TATGATGGAGACTGGCCTTGGAAAGAAGATCCTCAAGCTTGGAGAGAATTACTGATTAAA
AGTTTCAAATTAGTTGGATTTAATAACTTCGTTGTTATACCAGTGGCTCTATACATAATC
ACTTTGAAGGACAATTACTAGATAAAGTACTCCTTTGAAATTGAGGATTTGCCAAATAGT
TTTACACTGGCTTGGCAAATGTTTTTCTGTATGATAGTACAAGACTTCTTTTTCTTTCTA
AGTCATTGGTTCTTGCATAAACCCTATTTCTACAAAAGAATACATAAGATTCATCACCAG
TACAACTAAACAGTGGGTTTCAGTGCAGAATATGCTCATCCCTTTGAATTCTTATTTGGA
AATGTAGTCCCATTTATCATTCCATGCTTGATTCTAGGCTCTAGATTACACTACTTCACT
TATTTTATCTGGGGATCGTTCAGGATTGCAAACACAGTATATGTTCATTCAGGCTATGAC
TTCCCTTGGGTTCCTAATGACATATGCATTTTCTATGGTAACTCAACATATCACGATTAT
CATCACAGTCATAATGTTGGGAACTTTGGAGGTATGATCACTCTATGGGATACTATTATA
GGAACAAATGGTTCATTTTTCAAGTATATTGAGGAGAAAGATAGATAAAAGAAACAAAAA
GGATAATGA


>Contig18492.0.g71(protein)
MSQQTKQSSSSSQDKKLRATKETVTVQKVIDREIQRYQRRGKTGIILAFIQIAFLLWIVP
QMGQIFWPKLLDLMKIYNLEKWQISFINSFGWSAISYFLYNFIFWIIYHLELPFFEQFKI
YDGDWPWKEDPQAWRELLIKSFKLVGFNNFVVIPVALYIITLKDNYQIKYSFEIEDLPNS
FTLAWQMFFCMIVQDFFFFLSHWFLHKPYFYKRIHKIHHQYNQTVGFSAEYAHPFEFLFG
NVVPFIIPCLILGSRLHYFTYFIWGSFRIANTVYVHSGYDFPWVPNDICIFYGNSTYHDY
HHSHNVGNFGGMITLWDTIIGTNGSFFKYIEEKDRQKKQKGQ